(data stored in ACNUC7421 zone)

EMBL: CP000947.PE67

CP000947.PE67        Location/Qualifiers
FT   CDS_pept        complement(63366..65936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0067"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; Clp domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; ATPase AAA-2 domain protein; SMART: AAA ATPase;
FT                   KEGG: hso:HS_0199 ATP-dependent Clp protease, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32329"
FT                   /db_xref="GOA:B0UV25"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV25"
FT                   /protein_id="ACA32329.1"
FT                   /translation="MNIDKLTTKFQQAIAEAQSLAIGKDHQFIEPVHLMTALLNQQDGS
FT                   IPPLLTASGGNLALLHNDLAAELSRLPQVSGNNGDIQVSRSLVKLLNLCDKLAQQRQDK
FT                   FISSELFLLAILEDKGALSESLKKCGIKQENLLQAIDKLRGGEKVNEQGAEENRQALEK
FT                   YTIDLTARAESGKLDPVIGRDEEIRRAIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVNGEVPEGLKGKRVLSLDMGALIAGAKYRGEFEERLKAVLKELAQEEGRVILFIDEIH
FT                   TMVGAGKTDGAMDAGNLLKPSLARGELHCVGATTLDEYRQYIEKDAALERRFQKVFVGE
FT                   PTVEDTIAILRGLKERYEIHHHVQITDPAIVAAATLSHRYISDRQLPDKAIDLIDEAAS
FT                   SIRMEIDSKPQPLDRLERRIIQLKLEQQALQKEDDEASRKRLDLLEEELGEKEREYAEL
FT                   EDVWKAEKAALSGAQHIKAELDNAKIQMEQARRISDFAKMSELQYGRIPELEKQLAQAE
FT                   SAEGKEMTLLRNRVTDEEIAEVLSRATGIPVAKMMEGEKDKLLRMEQELHKRVVGQSEA
FT                   VVAVANAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKTLANFMFDDENAMVRIDMS
FT                   EFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHSDVFNILLQVL
FT                   DDGRLTDGQGRTVDFRNTVVIMTSNLGSDLIQGNKELDYNAMKEVVMSVVGQHFRPEFI
FT                   NRIDETVVFHPLAKENIRAIATIQLQRLVKRMETHGYQLEFTDATLDFIGEVGYDVIYG
FT                   ARPLKRAIQQEIENPLAQQILSGQLLPGKKVIVDYVDGKVVAKQ"
     atgaacatag ataaacttac gactaaattt caacaagcta ttgctgaagc tcaatcttta        60
     gccataggaa aagaccatca atttattgaa ccagttcatt taatgaccgc acttttaaat       120
     cagcaagatg gttcaatccc gccattatta acagcaagtg ggggaaattt agcattattg       180
     cataatgact tagctgcaga attgagccgt ttaccacaag tttcggggaa taatggggat       240
     attcaggttt ccagaagttt ggtcaaatta ttaaatttat gcgacaaact ggcacaacaa       300
     cggcaagata aatttatttc ctctgaatta tttttattag caattcttga agataaaggt       360
     gctttaagtg aaagtttgaa aaagtgcggt ataaaacaag aaaatttact acaagccatt       420
     gataaattgc gaggaggcga aaaagtgaat gaacaaggtg cggaagaaaa tcgtcaggca       480
     ttagaaaaat atactattga tttaactgca cgggcagaaa gtggaaaatt ggatcctgtt       540
     atcgggcgtg atgaagaaat tcgccgtgcc attcaggttt tacaacgtcg tacaaaaaat       600
     aatccagtat taattgggga accgggtgta ggtaaaacag cgattgtgga agggttggca       660
     caacgtatcg taaacggtga agtacctgaa ggcttaaaag gaaaacgtgt tctttctctg       720
     gatatgggag cgttaattgc gggagccaaa tatcgtggtg aatttgaaga gcgtttaaaa       780
     gcggttctca aagaattagc tcaagaagaa gggcgtgtga ttttatttat tgatgaaatt       840
     cacactatgg taggtgcggg aaaaactgac ggggcaatgg atgcgggaaa tttgttaaag       900
     ccaagtttag ctcgtggtga actgcattgt gtaggtgcaa caactttaga tgaatatcgt       960
     caatatattg aaaaagatgc cgcacttgaa cgccgtttcc aaaaggtatt tgttggtgag      1020
     ccgacagttg aagatacgat tgccatttta cgtgggttaa aagagcggta tgaaattcat      1080
     caccatgtgc aaattaccga tccggcaatt gttgcggcag cgaccctttc tcatcgttat      1140
     atttccgatc gtcaattacc agataaagct attgatttaa ttgatgaggc agcctcaagt      1200
     attcgtatgg aaattgatag taagccacaa cctttagata gattagaacg ccgtattatt      1260
     caattaaaat tggaacaaca agcgttacaa aaagaagatg atgaagcaag tcgcaagcgt      1320
     ttggatcttc ttgaggaaga gcttggtgaa aaagaacgtg aatatgcgga gttggaagac      1380
     gtttggaagg cggaaaaagc cgcactttcg ggtgctcaac acatcaaggc agagctggac      1440
     aatgccaaaa ttcaaatgga gcaagctcgc cgaatcagtg attttgcgaa aatgtctgag      1500
     ttgcagtatg gtcgtattcc tgagctggaa aaacagcttg cacaagctga aagtgcggaa      1560
     ggaaaagaga tgactttatt gcgaaatcgt gttaccgatg aggaaatcgc tgaagtgctt      1620
     tcacgtgcga caggcattcc tgttgcaaaa atgatggagg gcgaaaaaga taaattattg      1680
     cgtatggaac aagaattgca taagcgtgtt gtaggacaat cagaggcggt tgttgctgtc      1740
     gcaaatgcta ttcgtcgtag tcgtgccgga ttatctgatc caaatcgtcc tattggctca      1800
     ttcttgttct taggaccaac gggcgtaggg aaaacggaac tgtgtaaaac cttggcgaat      1860
     tttatgtttg atgacgaaaa tgcaatggtg cgtattgata tgtccgaatt tatggaaaaa      1920
     catagcgttt cacgtttagt cggtgcacct ccgggctatg tcggttatga agaaggcggt      1980
     tatttaaccg aagcggtacg tcgtcgtcca tattctgtga ttttgcttga tgaagtggaa      2040
     aaagcccata gcgatgtctt taatatttta ttgcaagtgc tagatgatgg acgtttaacc      2100
     gatggacagg gcagaacggt tgattttcgt aatactgtag tgattatgac ttcaaattta      2160
     ggctctgatt taattcaagg caataaagag ttggattata atgctatgaa agaggttgtt      2220
     atgtcagttg tagggcaaca tttccgacct gaattcatca accgtattga tgaaactgtg      2280
     gtattccatc cattagctaa agaaaatatt cgtgccattg ccactattca attacaacgc      2340
     ttagtgaaac gtatggaaac tcatggttat cagcttgaat ttaccgatgc gactttagat      2400
     tttatcggtg aagttggcta cgatgtgatt tacggtgcaa gaccattaaa acgtgccatt      2460
     caacaagaaa ttgaaaatcc attagcacaa caaatcttat ccggacaatt attaccgggt      2520
     aaaaaagtca ttgtggatta tgttgatggg aaggttgttg caaaacagta g               2571
//

If you have problems or comments...

PBIL Back to PBIL home page