(data stored in ACNUC7421 zone)

EMBL: CP000947.PE68

CP000947.PE68        Location/Qualifiers
FT   CDS_pept        complement(66120..66581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0068"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   hso:HS_0200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32340"
FT                   /db_xref="GOA:B0UV26"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV26"
FT                   /protein_id="ACA32340.1"
FT                   /translation="MLLPFILIALCAGIALAAQAAINTQLAQSLSGQPVFAAFVSFAMG
FT                   TIALFFICWWKMDLFSALQQVPKQPLWKLIGGLLGALAVFTTIFLAPKIGVTNMLFFII
FT                   VGQLLTALIIDHFGLIGMTQRAVNVWQLIGFVVIGFGLLLFFFGKKLFH"
     atgttacttc catttatatt aattgcatta tgtgcaggga tcgcattagc cgcacaagcg        60
     gcaattaata ctcagttagc acaatctctc tcgggacaac ctgtctttgc agcctttgtt       120
     tcctttgcga tgggaacgat agcgttattt ttcatttgct ggtggaaaat ggatttattt       180
     tcagcactac aacaagtccc taaacagccc ttatggaaac tcatcggcgg tttattaggt       240
     gcattagcgg tatttaccac tatctttctt gcacccaaaa tcggcgtcac caatatgctg       300
     ttctttatta ttgtcggtca attactgact gctttgatca ttgatcattt cggtttaatc       360
     ggaatgacgc aaagagcggt aaatgtttgg caacttatcg gttttgttgt catcggtttc       420
     ggtttattgt tatttttctt tgggaaaaaa ctttttcatt aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page