(data stored in ACNUC7421 zone)

EMBL: CP000947.PE69

CP000947.PE69        Location/Qualifiers
FT   CDS_pept        66765..67022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0069"
FT                   /product="sodium pump decarboxylase, gamma subunit"
FT                   /note="TIGRFAM: sodium pump decarboxylase, gamma subunit;
FT                   PFAM: sodium pump decarboxylase gamma subunit; KEGG:
FT                   hso:HS_0201 oxaloacetate decarboxylase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32351"
FT                   /db_xref="GOA:B0UV27"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="InterPro:IPR023424"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV27"
FT                   /protein_id="ACA32351.1"
FT                   /translation="MTNTNVQLIQEGVNLMLSGMGFVLVFLLILIFAIKLMSKLIGYFS
FT                   SEPTLPQQAFIPTTELNDLERLRPVIVAAIAHHRRQQNLQ"
     atgacaaaca caaacgtaca actcatacaa gaaggcgtaa atctaatgct ttccggtatg        60
     ggctttgttt tagtcttttt attaatttta atttttgcta taaaactgat gtctaaactt       120
     atcggttact tttcatctga accaaccctt cctcagcaag cgtttattcc tacaacagaa       180
     ttaaatgatt tagagcgttt acgtccggtt attgtagcag caatagcaca tcaccgtcgt       240
     caacaaaatt tacaataa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page