(data stored in ACNUC7421 zone)

EMBL: CP000947.PE70

CP000947.PE70        Location/Qualifiers
FT   CDS_pept        67035..68834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0070"
FT                   /product="oxaloacetate decarboxylase alpha subunit"
FT                   /note="TIGRFAM: oxaloacetate decarboxylase alpha subunit;
FT                   PFAM: biotin/lipoyl attachment domain-containing protein;
FT                   pyruvate carboxyltransferase; Conserved carboxylase region;
FT                   KEGG: hso:HS_0202 oxaloacetate decarboxylase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32363"
FT                   /db_xref="GOA:B0UV28"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV28"
FT                   /protein_id="ACA32363.1"
FT                   /translation="MATHEKKISITDVVLRDAHQSLFATRLRLDDMLPIAAELDKIGYW
FT                   SLEAWGGATFDACIRFLGEDPWVRLRELKKAIPNTPLQMLLRGQNLLGYRHYADDVVNK
FT                   FVERAVANGMSVFRVFDAMNDPRNMQQALRAVRKNGGHAQGTLSYTTSPVHTLETWLDT
FT                   TEQLLEIGIDSLVIKDMSGILSPVEAYKLVSEIKKRYDVRLHMHCHSTTGMAEMALLKA
FT                   IEAGADGIDTAISSMSGTYGHPATEALVATLDNTQYDTGLSIPQLERIADYFRNVRKKY
FT                   AKFEGQLRGVDSRILVAQVPGGMLTNLENQLKQQNASDKLDKVLQEIPKVRADLGYIPL
FT                   VTPTSQIVGTQAVINVLMGERYKTIAKETAGILKGEYGRTPAPVNAELQAQVLAGEQPI
FT                   TDRPADHLAPEMDKLSTEIKRMVKEKGIQLAENEIDDVLIVALFPQVGLKFLENRGNPN
FT                   AFEPVPTNEVKTSEKPTALSSRNDSAVYTVEVEGKSFVVKVTEGGDISHITPVSTAPST
FT                   QSTEPATSATTKNIPVNAPMAGNIWKVLVKEGQQVAEGEVLLILEAMKMETEIRAATSG
FT                   TVQGIKVKAGDTVAVGDILLTLA"
     atggctactc acgagaaaaa aatttctata actgacgtgg ttttacgtga tgcacaccaa        60
     tccctttttg ctacacgttt acgccttgat gatatgctac ctattgccgc tgaactggat       120
     aaaatcggct actggtcgct tgaagcttgg ggaggtgcaa cttttgatgc ttgtattcgc       180
     tttttagggg aagatccttg ggttcgttta cgtgagttga aaaaagctat tccgaacacg       240
     cctttgcaaa tgttattacg tgggcaaaat ttattgggct atcgtcatta tgctgatgat       300
     gttgtaaata aatttgttga acgtgcggtt gcaaacggta tgagcgtttt ccgtgtattt       360
     gacgcaatga atgatccgag aaatatgcaa caagcgttaa gagcggtgcg taaaaatggc       420
     ggacatgcac aaggtacatt gagttataca acaagtccgg tgcatacttt agaaacgtgg       480
     ttagatacca cagagcaatt gttagaaatc gggatcgact cgctggtcat taaggatatg       540
     tccggaattt tatctcctgt cgaggcatac aaattagtca gcgaaatcaa aaaacgctac       600
     gatgtgcgtt tacatatgca ctgtcattca acgacaggta tggcggaaat ggcattactc       660
     aaagccatag aagcaggtgc ggatggtatt gacacggcaa tttcctctat gagcggtact       720
     tacggacatc cagcaacaga ggcattagta gctacattag ataacacaca gtacgatacc       780
     ggattaagta ttccacaact tgagcgtatt gctgattatt tccgtaatgt acgcaaaaaa       840
     tacgctaaat ttgaagggca attgagaggc gtggatagcc gtattttagt tgctcaagta       900
     ccgggaggaa tgctgactaa tttagaaaat caactcaaac aacaaaatgc ttcagataaa       960
     ctggataaag ttttgcagga aattccaaaa gtgcgggctg atttaggcta tattccgcta      1020
     gttacaccaa cctcacaaat tgtcgggact caagcagtga ttaatgtatt aatgggtgag      1080
     cgttataaaa ccatcgcaaa agaaaccgca ggtattttga aaggggaata tggtcgcacc      1140
     ccggcaccgg tgaatgcaga attacaagca caagtcttag cgggtgagca acctattact      1200
     gatcgtccgg cagatcatct tgcaccggaa atggataaac tatccacaga aataaaacga      1260
     atggtaaaag aaaaaggtat tcaacttgca gagaatgaaa ttgatgatgt attaattgtt      1320
     gcacttttcc cacaagttgg gctgaaattc ttagaaaatc gaggtaatcc gaatgctttt      1380
     gagccggtac caaccaacga agtaaaaaca agtgaaaaac cgaccgcact ttcaagtaga      1440
     aatgatagtg ccgtttacac ggttgaggta gagggaaaat cttttgtagt gaaagttact      1500
     gaaggcggtg atattagtca tattacacct gtctcgaccg cacctagtac acaatcaaca      1560
     gaaccggcaa caagtgcaac tacaaaaaat ataccggtaa atgcacctat ggctggaaat      1620
     atctggaaag tactggtaaa agaaggacaa caagttgcgg aaggagaagt cttgctcatt      1680
     ttagaagcaa tgaaaatgga aacagaaatt cgagccgcta cctcaggaac tgtacagggt      1740
     ataaaagtga aagcgggtga tactgtggct gtgggtgata tcttattaac tttagcgtaa      1800
//

If you have problems or comments...

PBIL Back to PBIL home page