(data stored in ACNUC7421 zone)

EMBL: CP000947.PE71

CP000947.PE71        Location/Qualifiers
FT   CDS_pept        68847..70151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0071"
FT                   /product="sodium ion-translocating decarboxylase, beta
FT                   subunit"
FT                   /EC_number="4.1.1.70"
FT                   /note="TIGRFAM: sodium ion-translocating decarboxylase,
FT                   beta subunit; PFAM: Na+transporting
FT                   methylmalonyl-CoA/oxaloacetate decarboxylase beta subunit;
FT                   KEGG: hso:HS_0203 oxaloacetate decarboxylase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32374"
FT                   /db_xref="GOA:B0UV29"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV29"
FT                   /protein_id="ACA32374.1"
FT                   /translation="MESILALLQGTGIMHLSWGQAIMLVISLLLLYLAVVKKFEPLLLL
FT                   PIGFGGLLSNIPEANMAFSALENLLHSNNNQHLSTLANLLHSDTDVQAIKQVLEKAPAL
FT                   LHVQAELLAKDLGYTDGVLSTFYDVAINSGAAPLIIFMGVGAMTDFGPLLANPKTLLLG
FT                   AAAQFGIFATVLGALALNGLGIIEFTLPQAAAIGIIGGADGPTAIYLASKLAPELLGAI
FT                   AVAAYSYMALVPLIQPPIMRLLTTKQERKIKMVQLRNVSNREKILFPIVLLVLVALLLP
FT                   DAAPLLGMFCFGNLMRVSGVVERLSDTAQNALINIVTIFLGLSVGAKLVADKFLQPQTL
FT                   GILLLGIIAFAIGTASGVLMAKLMNCFSKDKINPLIGSAGVSAVPMAARVSNKLGLEAD
FT                   HQNFLLMHAMGPNVAGVIGSAIAAGVMLKYIAAMM"
     atggaaagta ttctcgccct attacaagga acaggcatta tgcatttaag ttgggggcag        60
     gcaattatgc ttgtcatcag cttgctctta ctctaccttg cagttgtgaa aaaatttgaa       120
     ccgctcttat tgctaccgat tggatttggg ggactcttat ccaatattcc tgaagcgaat       180
     atggcgtttt cggcactaga aaatttactt catagcaata acaaccaaca tttatctacg       240
     cttgcaaatt tactgcatag cgataccgac gtacaggcaa taaaacaggt actggaaaaa       300
     gcaccggcgt tgttacatgt gcaagcagaa ttattagcga aagatttagg ctataccgat       360
     ggtgtgttgt ccacttttta tgatgtcgcc attaattcag gtgccgcacc attgattatc       420
     tttatggggg ttggtgcaat gacggatttt ggtccattgc ttgctaatcc aaaaacctta       480
     ttactgggtg cggctgcaca attcggaatt tttgccactg tgctaggggc gttagcatta       540
     aacgggttag ggatcattga atttaccttg cctcaagctg cggcaatagg gattattggt       600
     ggtgctgatg gtccaaccgc tatttatctg gcaagtaaac ttgcccctga attattgggg       660
     gctatcgccg ttgctgctta ttcctatatg gcattagtcc cacttatcca accgccaata       720
     atgcgtcttt taaccactaa acaagagcgt aaaattaaaa tggtgcaact gcgtaatgtc       780
     agtaatcggg aaaaaatctt gttcccgatc gtgttattgg tgcttgttgc tttattattg       840
     ccggatgccg caccgttatt aggaatgttt tgctttggta atttaatgag agtaagtggg       900
     gtagttgagc gtttaagtga tactgcacaa aatgccttaa tcaatattgt aacaattttc       960
     ctcggattat ccgttggtgc aaaattagtt gcagataaat tcctacaacc gcaaacgtta      1020
     ggtatcttat tgctcggcat aatagctttc gccataggga cagcgagtgg cgtcctaatg      1080
     gcaaaattga tgaactgctt tagtaaagat aaaatcaatc cgcttatcgg ttcggcaggt      1140
     gtttccgccg tgccaatggc ggctcgagta tcgaataaat taggcctaga ggctgatcat      1200
     cagaactttt tattaatgca cgcaatggga ccaaacgttg ccggcgtgat cggatccgcc      1260
     attgcagcag gcgtgatgtt aaaatatatt gcagcaatga tgtaa                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page