(data stored in ACNUC7421 zone)

EMBL: CP000947.PE75

CP000947.PE75        Location/Qualifiers
FT   CDS_pept        complement(74958..76127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0075"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: hso:HS_0207
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32418"
FT                   /db_xref="GOA:B0UV33"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV33"
FT                   /protein_id="ACA32418.1"
FT                   /translation="MSVIKMTDLDLAGKRVFIRADLNVPVKEGKVTSDARIKATIPTLK
FT                   LALEKGAKVMVTSHLGRPTEGEFKPEDSLQPVVDYLKGAGFNVRLAQDYLNGVEVNEGE
FT                   IVVLENVRVNKGEKKNDPELSKKYAALCDVFVMDAFGTAHRAQASTYGVAEFAPVACAG
FT                   PLLAAELEALGKALKEPQRPMLAIVGGSKVSTKLTVLDSLSKIADQLIVGGGIANTFIA
FT                   AEGHNVGKSLYEADLIPEAQRLSKVTNIPVPVDVRVGTEFSETALSTEKSVADVSGEES
FT                   IFDIGDKSAEQLADIIRNAKTILWNGPVGVFEFPNFRKGTEIVSNAIAEATANGAFSIA
FT                   GGGDTLAAIDLFGIKDKISYISTGGGAFLEFVEGKVLPAVEILEKRANG"
     atgtcagtaa ttaaaatgac cgacctagat ttagcaggta agagagtatt tattcgtgca        60
     gatttaaatg tgccggtaaa agaggggaaa gtcacttccg atgcacgtat caaagcaact       120
     attcctacgt taaaacttgc acttgagaaa ggtgctaaag tgatggtaac ttctcattta       180
     ggtcgtccga cagaggggga atttaaacct gaagattcat tacagcctgt tgttgattat       240
     ttgaaaggtg ccggttttaa cgttcgttta gcacaagatt atctaaacgg tgtagaagtc       300
     aatgaaggtg aaattgttgt tcttgaaaac gtacgtgtga ataaaggtga gaagaaaaat       360
     gatccggaat taagtaaaaa atatgccgca ctttgtgatg tatttgttat ggatgctttc       420
     ggtacggctc accgtgcaca agcctcaact tacggtgtag cggagtttgc ccctgttgct       480
     tgtgccggtc cattattagc ggcggaatta gaggcgttag gtaaagcatt aaaagagcct       540
     cagcgtccaa tgttagcgat tgtgggaggt tcaaaagtat ccactaaatt aactgtcttg       600
     gacagcttat caaaaattgc tgaccaactg attgttggtg gcggtattgc gaatactttc       660
     attgctgcag aggggcataa tgtgggtaaa tccttatatg aagcggattt aattcctgaa       720
     gcacaacgtt tatcaaaagt aacgaatatt cctgttccag ttgatgtgcg tgtgggcact       780
     gaattttcag aaaccgcact atcaacagaa aaaagtgtag ccgacgtttc cggagaagaa       840
     tccatttttg atattggtga taaatcagca gagcaattgg ctgatattat ccgcaatgca       900
     aaaactattc tttggaatgg tcctgtgggg gtttttgaat tccctaactt tcgtaaaggt       960
     actgaaatcg tttctaatgc gattgctgaa gcaaccgcaa atggtgcttt ctctattgct      1020
     ggtggtggtg atactttggc agcgattgat ttattcggta tcaaagataa aatttcttat      1080
     atttcgaccg gtggtggtgc attcttagag tttgtagagg gcaaagtatt accagcggtt      1140
     gaaattttag aaaaacgagc aaatggttaa                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page