(data stored in ACNUC7421 zone)

EMBL: CP000947.PE77

CP000947.PE77        Location/Qualifiers
FT   CDS_pept        complement(76675..88866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0077"
FT                   /product="YadA domain protein"
FT                   /note="PFAM: YadA domain protein; Haemagluttinin domain
FT                   protein; Hep_Hag repeat-containing protein; KEGG:
FT                   hso:HS_0790 possible large adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32440"
FT                   /db_xref="GOA:B0UV35"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV35"
FT                   /protein_id="ACA32440.1"
FT                   /translation="MNKIFKTKYDVTTGQCKAVSELASNRQIASSSKSKPKCGVFLGNF
FT                   LGIFKFSPLVLLMSGMLGVSSVSYADITYIDMDGNTGAAGVRENWREADYWKKNGRENT
FT                   LLTQVQNSPRKYDKDVNTNVYKSVIIGPHSAGVNTNRDQSTGVGMTILGHGAVGFASQT
FT                   TAIGNNVYSGGQQATALGSDVMAAGYASIAIGNDDIANTYRDKLPEKTIMKIYGYDTNT
FT                   RYSGTTYKNILNEQNFKMKYGINNGVDNRIYSPTYAAGVASIAIGSRSVAYGNASLAIG
FT                   TLSFALANDSTAVGVRAFVNDDATGGVAIGDESRVFAANSFAIGNETEATNQGALTFGS
FT                   GSKAVGIGSIAIGSNVASNALIASNGYETFQNSIMQHTQNSSPVVEVDRHNEYNTLFKI
FT                   DENNLKYGDENHIVKLGFNASNPSNSKNPISEIIEKVISDKKRIAFSHERDEVIETTSK
FT                   IYKTTKEGDHSISLGYHLSNNGDNTITIGSASVVRGANSVVLGALNNIGKYARNTIALG
FT                   IGTNVYKENSVAIGTGINVIGAGAVAIGSGVGVTKDNTISIGYGSHGLSSESIVLGNSA
FT                   SLKDHSKKSILIGNSAKVENQSQNKNVKIANLKKGKFGLEAEKVELEMSAISIGTESYV
FT                   YSEKGIALGDNAKIEANSENAIAFGTNSKASKKSAIALGNETEATMENSVALGYKSHTK
FT                   YFYQDANKNTATLTGKEAIDLTPYVPEGSSYSLRTDKSAGIISVGWTKGNSGSQELGLR
FT                   RIVGVAPGALDSDVATIGQLKALEYVKREGLVVYYTEDNGKIYKLVKGTDGKFYKVNTK
FT                   NGTPLDKQEIPKEKVLVGAKGHNEKIQYINADKQIADIGEKIRFGHLADGEISQTSDQA
FT                   ITGNQLKNVGDILGVSVNTPNNTQFDRYKFTAVDYKGSQKKQKTIFKDAIEELITAVNK
FT                   GIVIQDADSHTGTLNLGSTLTIKAGNIDKPKSDVDGFSSDNIKTSYQPTRKELLIGIKD
FT                   KPIFKEVTISGTVNDRSDKKTLTTKEYVDGKLANVATSFTVNGNMGNYIVQSALNIKGK
FT                   ADASQHKNITTEAKTNEKELEISLNKDLKDIASITGEGIKSGKNTVYSKIAFNSTNGSN
FT                   ATTNVTISSNGANYTFDRTGFDMSDRRITRLQSGLNTQHHGPKGANGNPENVSKILDGS
FT                   YITTIKGNAVNVSDLSNVAKAIVEKGLKFAGDSGSEITRKLGEKLTIKGNGTDLTSKTD
FT                   SNKGEITFTLHKATSIDDNTATNSNKDKVVTAGAVKTYLDSKIDEVSTTLGLEADNSKN
FT                   SGPTGKVNLKNEKLKVAGTSDEIETKVEQDKQSITLSFAQNTKNKLGMITVDGDKLALG
FT                   KNAKTVDKMTAPKEAKVTVGNDSLKFNWTGGVSADDKEQSKKSVISVGDTGKEHLITHV
FT                   AAGKVEVNSTDAINGSQLYGVVDAFSKLAINVLGAKADLTSGFKKSSFDVVKYNGNTNT
FT                   QTSKEMTFKDAIGQNTTAINKGFIFGVGDSNNEQGTHYLGDKLIIKAGAVDKPTSTSDD
FT                   GYSPDNIKTAYLAKSKELLIGIKDKPTFKEVKVSGTVDDSSDGKTLTTKTYVDGKLANV
FT                   AANFDVKGDNNVVYTLNKQNNVLNINGDTKNITTAVDKNAKKVSITLKEALTGITSIGK
FT                   DTNNQIAFSDSGTILKAGGSSLNLTGSSGKVKISNVANGTSDNDAINKSQLNSVVSALG
FT                   GEAKIGADGNVIAPSYTLANGNKAPYTTVGEALSALDEVLTSVNGAGITFSDGTTNNDF
FT                   VRKNSENDKKVVIKSGSNINVSLSKTNSDKTGEFTVALNKDLEDINSITLKDSGGHSAT
FT                   NKTGKITIDGVTGDVKVQHGDGRASKIVIESGLNALTGNDEIQVTGGGKVFGNASLSLK
FT                   DASIAGTKLKDNTIAEAKLDQGIKDKLNKTFMVKAEGATSDNLIGNTLEFAAKDSNLTV
FT                   ELDKSNKKISYGLSSTLTGIESIAKDKTKISLADTKIKLMPEEGAALTLTKSDTDKVKI
FT                   SGLGDGQIDGASNEAITGKQLHDLAGKLGVTVDNAKAGFTQPSFTKVNYQGQTETNGKT
FT                   TFKEAINDLIVAVNKGLVVGDGTVKGTLQLGDTLQIKAGNIDKKSTSDDGFSSDNIKTS
FT                   YQQNTKELLIGIKDKPSFKQVTVTEEINEKSPKTALTTKKYVDSKATQNEQAIANQEIK
FT                   YKANGAGDNKVKLSEGLDFKNDDNITVTADAGGAITHKLNADLKNITSIAGKGDSGTAP
FT                   KIDFANGDGLKISSKGTDLTLKADGLDLNNKQITGIASGLDQKMNGASGRQDLDELLKL
FT                   VATGQPQNGGTSNDGKLNKAINAGDLLHIANELKNKGLSFQGNDGKDVTRKLGETLKIV
FT                   GETSATTPTDSTQPAMETAPDNITVAKKTGNGDDTLEIKLSKNLKGIASIANGDKAKIA
FT                   LDKDKGTITFTAGDQARSKDVTLSAGKFSGVSEINKEEGKGALKLTENTATLESAKDNS
FT                   KLELKDKAVTLESTKDGSSVTLDGTSATLSAGKNKGSIKVTNGADNKIELSPENGSTVM
FT                   LKKDMTNGGVQATGLSTIGKDDDNALVFKNSTSGTDKTAELKVGGSALTFTKATTGNTV
FT                   KISNVEDGKIDTSSTEAITGKQLHDLASKLGVEVESETGFKQPSFTAIKGGTSSTGGTT
FT                   NSNTGPTTFKEAINQLITAVNGGLTFKGNDNGSSPSSTTLQLGGTLTIDSSTSKVKADG
FT                   MAEATQKDITVSLAPSNGNNPQSAGTLTLKLNKATTVSETDEKVVTSKAVATKLKEYTT
FT                   TAQLQTDFLKVDGSNIGDKKLALGKNVGIDTIKLGETEKSTTELVQADAVIKYLKGTGD
FT                   KSVKVSDNPETKADGEGSIAIGDKAVAENEGAIAIGYDTSAKNRRSVAIGREAQVLGEH
FT                   ATAIGYKNNVSGNDSGAFGKDNEIIGKHSYAVGAYNKIEGDHVYALGSNITTTKDITNA
FT                   VILGNKSTGVSNAVSVGGAGKDEQRRIVYVATPTDKYDAVNKKYVDDLTLSYKTNSDDK
FT                   TKQSINLKTGALDFKKSENISVSVEADGKITHTLNNNLQEITSIKGGKDESGAKITLET
FT                   AKKEISFNDSKLTNLADGEIGDSSKEAVTGKQLADLAKQLGIAVDTSDKTKFTAPTFDN
FT                   FKLKDINGTDGTAPKNIVEGLKNAVSKLNEGLKFSADMPSAVANGTQSTPHYLGSTLSI
FT                   VRLDMNQAGSSATPAPAGTSSQPNIAEFKGDNLITQYTREANGNAKIEIGFKNAPTFSK
FT                   VMLAEEQTYNGVNGNSGSTDWKKELITKGYLEQALDKFKFKVENGSGKTIEIGRNDTLK
FT                   FTSGQNIKVDLAKNGTTPSSTGSTSPSASAPAPTPAAPASVSSAAPSSSSGGAGSNGGG
FT                   SNSMASSGGSNGAGMATTTPTSAPTTTPTTTTPTTTAVVTIGTTEELKNITSISSKPKA
FT                   GSAGGSGTGSSAVGNQDEVTKLTLDAEKGATFQVGNQGTEVNINKDGISLTPQSKDGKA
FT                   TLNKDGLTVGDKEAANGDKTHTVYGKDGLTVKGKDSSKEVVSLKVADGENSQGNNGGNG
FT                   QSATLAFAKIGNGSGAGTGADAKGTGTGKITGLADIKPDEKDGTLATNKNYVDGKVSDL
FT                   NNNRPFDFYLNGEKVVKDKDGNFKKLKDGKPDQLLTEEEKKQVVIKAEPSTAPIGISNV
FT                   ASGLGITTPTKDEKKQLSELAEKVNEKVEALGEKAKTLSDTATKLADLELMVDSLKQTI
FT                   DTLPDGEAKEKIRENLKKYETQLSDAQEAKKNAEEAVESARNELIEANGDYNAFSEAMA
FT                   KVEELVEPDSQANLSNVATVGDLQAVARAGLNFVGNDDVTVHKNVGETLSITGEGTFNS
FT                   NRTATGNIKVEMAQDGKGLEVKLSDQLKNMTSFETREVEGRKSTLDSNGLRVVNKGKDG
FT                   TDDKAKSATYGAEAVVLEDKNKSDKAVITAGGIRFADSSTQTTALSTELNKNGLTVNGA
FT                   GGQIHIDGTKGVITVPNIKPNADGHVVVNKNYVDTKNNELRTQMNNNDRNMRAGVAQAV
FT                   AQANLPINILPGKSTLSLATGNYMGSQAFAVGYSRVSDNGKLSVKFSLGHGDKKTSVGA
FT                   GVGYSW"
     atgaacaaaa tcttcaaaac aaaatacgat gtaacaacag gtcaatgtaa agccgtttct        60
     gagttggcaa gcaaccgcca aatagcgagc agttcgaaga gtaaaccaaa gtgcggtgtg       120
     tttttgggta attttttagg catttttaaa ttttcaccgt tggtgttgtt gatgtcgggg       180
     atgcttggtg tgagcagtgt ttcatatgct gacataacat atattgatat ggacggaaat       240
     accggagcag cgggtgtacg agaaaattgg agggaagcag attattggaa aaaaaacggt       300
     agagaaaaca ctcttctaac acaggttcaa aatagtcctc gtaaatatga taaagatgtt       360
     aatactaatg tatataagtc tgtaataata ggccctcact ctgcaggcgt gaatacgaat       420
     cgcgatcaat ctactggtgt aggtatgact attttaggcc atggtgctgt aggttttgct       480
     tctcaaacaa ctgcaatagg aaacaatgta tattctggag ggcaacaagc aactgcttta       540
     ggatcggacg taatggctgc tggttatgct tctattgcaa tagggaatga tgatatagct       600
     aatacatatc gagacaaatt acctgaaaaa accattatga aaatctatgg ttatgataca       660
     aacacaagat atagtggaac tacttataaa aatatattaa atgaacagaa ctttaagatg       720
     aaatacggaa taaataacgg tgtagataac cggatttatt ctcctactta cgcagcaggc       780
     gtggcatcaa tagccattgg ttcaagatct gttgcctatg gaaatgcttc actagctata       840
     ggtacattat catttgcttt agcaaatgat tctactgcag ttggagttcg tgcgtttgtt       900
     aatgacgatg caactggagg agttgctata ggagacgaat caagggtttt tgctgcgaat       960
     tcatttgcta taggtaatga aacagaagca actaaccaag gtgcattaac attcggttca      1020
     ggatcaaaag cagtaggaat tggatcaata gccatagggt caaatgtagc atctaatgct      1080
     ttaatcgcaa gtaatgggta tgagacattt caaaattcca ttatgcaaca cacacaaaat      1140
     tcatctcctg ttgtagaagt agatcgacat aatgaatata acaccctttt taaaatcgat      1200
     gagaacaatt taaaatacgg agatgaaaat catattgtca aacttggttt taatgcttct      1260
     aaccctagta atagtaaaaa tccaatatca gagataattg aaaaagtaat tagcgacaaa      1320
     aaacgaatag cctttagtca cgaaagggat gaagtcattg aaacaacaag taaaatatat      1380
     aaaacaacta aagaaggaga tcactctata tctttaggat atcatctttc aaataatggg      1440
     gataatacta ttactatagg tagtgcatca gtagtaagag gagcaaactc tgtagtatta      1500
     ggggcattaa ataacatcgg taaatatgca cgaaatacca tcgcacttgg gattggtact      1560
     aatgtatata aagaaaactc tgttgctatc ggtacaggaa taaatgtcat cggtgcagga      1620
     gcagttgcaa taggttccgg agttggtgtt acaaaagaca atacaatatc aatagggtat      1680
     ggttctcatg gattatcaag tgaaagtata gttctaggaa attctgcaag tttaaaagat      1740
     cattcaaaaa aatctatact aataggtaat agtgcaaaag ttgaaaatca aagtcaaaat      1800
     aaaaatgtaa aaatagcaaa tttaaagaaa ggaaaatttg gacttgaggc tgaaaaagta      1860
     gaattagaaa tgtcagcaat ttctataggt acagaatcat atgtttattc tgaaaaaggg      1920
     atagctttag gagataatgc aaaaattgaa gcaaattctg aaaatgcaat tgctttcggg      1980
     actaattcaa aagcgagtaa aaaaagtgca atcgctttag gtaatgaaac cgaagcgacg      2040
     atggaaaact ccgtcgcctt gggctataaa tcacatacaa aatattttta tcaggatgct      2100
     aacaaaaata cagcaacctt aaccggaaaa gaagccattg atttaacccc atatgttcca      2160
     gaggggtcaa gctatagttt aagaactgat aaatcagcgg gtatcatttc agtcggttgg      2220
     acaaagggta acagtggaag tcaagaactg ggcttaagac ggattgtcgg ggtggcaccg      2280
     ggtgcgttgg attctgacgt ggcgacgatt ggacaattaa aagccttaga atatgtaaaa      2340
     agagaaggct tagtcgttta ttatacggaa gataatggaa aaatatataa attagttaaa      2400
     ggaacagatg gaaaattcta caaggtcaat accaaaaatg gcacaccatt agataaacaa      2460
     gaaattccaa aagaaaaagt attagttggg gctaaagggc ataacgagaa gatacaatac      2520
     ataaatgctg ataaacaaat tgcggacata ggagaaaaga taagattcgg gcatttagcc      2580
     gatggagaga tttcgcaaac ttccgatcag gcgattacgg ggaatcagct taaaaatgtg      2640
     ggtgatattt taggtgtgtc agtaaatacc cccaataaca cgcaatttga tcgttataag      2700
     tttacagcgg ttgactataa aggttctcaa aagaaacaaa aaactatttt taaagacgct      2760
     attgaagaac tgattacagc ggtaaataag ggaattgtaa tccaagacgc tgacagccat      2820
     acaggtacac ttaatttagg ttcgacgtta actattaaag cgggaaatat cgataaacca      2880
     aaatctgatg tagatggatt tagcagtgat aatattaaga caagctatca accaactaga      2940
     aaggaactgt taatcggtat caaagataaa ccgatattta aagaagtaac aataagtggc      3000
     actgtgaatg atagaagcga taaaaagaca ttaacaacga aagaatatgt cgacggaaaa      3060
     cttgccaatg ttgcaactag ttttactgta aatggtaata tgggaaacta tattgttcaa      3120
     agtgcattaa atattaaggg gaaagcagac gctagccaac ataaaaatat tactactgaa      3180
     gctaaaacta atgaaaaaga gttggaaata tctttaaata aagacttaaa agacattgca      3240
     agtattactg gagaagggat taaaagcggt aaaaatactg tatatagcaa gatagcattt      3300
     aatagcacaa atgggtcaaa tgcaacgaca aatgtaacaa tttcatcaaa tggggcaaac      3360
     tatacatttg atagaacggg ctttgatatg tccgatagaa gaattacccg attacaaagc      3420
     gggttaaata cacagcatca tggacctaag ggagcgaacg gaaatccgga aaatgtttca      3480
     aaaatattag atggcagtta cataacaaca attaaaggaa atgctgtcaa tgtcagcgat      3540
     ttatccaacg tagcgaaagc gattgtggaa aaaggactaa aatttgccgg agattccggc      3600
     tctgaaatca cccgtaaatt gggcgaaaaa ctcaccatta aaggcaatgg tacggatctg      3660
     acttctaaga ctgatagcaa caaaggggaa attaccttta ctttgcacaa agcaacaagc      3720
     attgatgaca atacggcaac aaatagcaat aaagacaaag ttgtcaccgc cggagcggtt      3780
     aaaacttatt tggattcgaa aattgatgag gttagtacaa ccttagggtt agaggcggat      3840
     aattctaaaa atagcggtcc gaccggtaaa gtgaatttga aaaacgaaaa acttaaagtg      3900
     gcaggaacga gtgatgaaat tgagacaaaa gtggagcagg ataaacaaag tattactctc      3960
     agttttgccc aaaataccaa aaacaaatta ggcatgatta cggtagatgg cgataagctc      4020
     gcattgggta aaaatgcaaa aactgtcgat aaaatgaccg cacctaaaga agcaaaagtg      4080
     actgtcggca atgacagtct taaattcaac tggacaggcg gagtcagtgc tgatgacaaa      4140
     gagcagagta aaaaatcggt gatcagtgtt ggcgataccg gcaaagaaca cctgattact      4200
     cacgttgctg cgggtaaagt ggaagtaaac tccaccgatg ctattaacgg aagccagtta      4260
     tatggcgtag tagatgcgtt ttctaaatta gctattaatg tattaggagc aaaagcagac      4320
     ctaacgagcg gatttaaaaa atcaagtttt gatgttgtta aatataatgg gaatacaaat      4380
     actcaaacat caaaagaaat gacctttaaa gatgccattg gtcaaaatac aacggctatt      4440
     aataaaggat ttatttttgg tgttggagat tctaataatg aacaaggaac gcattactta      4500
     ggcgataaat taatcatcaa agcgggagct gtagataaac caacgagcac ttcagacgac      4560
     ggttattcac cggataatat taaaacagcg tatctagcaa aaagcaaaga gctgttaatc      4620
     ggtatcaaag acaaaccgac ctttaaagaa gtcaaagtga gtggaacagt cgatgatagt      4680
     agtgatggga agacattaac cacgaaaacc tatgtggacg ggaaattagc taatgtcgcc      4740
     gctaattttg atgttaaggg ggataataac gtagtatata cattaaataa acagaacaat      4800
     gtcttaaata ttaatggcga tactaaaaat atcaccacgg cagtggataa gaacgctaaa      4860
     aaagtcagta tcacattaaa agaggcttta acgggcatta catctattgg taaagatacc      4920
     aataatcaaa tcgcattttc ggatagcggg acaatcctta aagctggtgg ttccagttta      4980
     aatttaactg gttctagtgg caaagttaaa atttccaacg tagcaaatgg tacatctgat      5040
     aatgatgcca ttaacaaatc gcaactcaat tctgttgtga gtgctttagg cggagaggcg      5100
     aaaataggtg cagacggaaa tgtaatagca ccgtcttata cgctagctaa tggaaataag      5160
     gcaccataca caaccgtggg agaggcttta tctgctcttg atgaggtgct cacttcggta      5220
     aatggggcag gtattacctt tagtgatggg actacgaata atgactttgt cagaaaaaat      5280
     agcgagaacg acaaaaaagt tgtcattaaa tcaggaagca atatcaatgt ttcattatct      5340
     aaaacaaatt ctgataagac gggagaattt acggtagcac taaataaaga cttagaagac      5400
     attaattcta tcactctaaa agatagtggt ggtcatagtg ctacaaataa aacaggaaaa      5460
     attactattg atggggttac tggagatgtt aaagttcaac acggtgacgg cagggcttct      5520
     aaaatagtta ttgaaagtgg attgaatgct ttaactggta acgatgaaat tcaagttact      5580
     ggtggcggaa aagtatttgg taatgcgtca ttaagtttaa aagatgcttc aattgcaggg      5640
     acaaaattaa aagataacac aatagcggag gcaaaactcg atcaaggtat taaagataaa      5700
     cttaataaaa catttatggt taaggcagaa ggtgccacta gcgataacct aataggaaat      5760
     actttagaat ttgcagcaaa agattctaat ttaactgttg aattagataa gtctaataag      5820
     aaaatatctt atggattaag ttcaacattg acgggaattg agtctatcgc taaagacaaa      5880
     acaaaaatct ccttagcaga tacgaaaata aagttaatgc ctgaagaagg tgcggcatta      5940
     acattgacaa aatccgatac ggataaggtc aagatttctg gactgggaga cgggcaaatt      6000
     gacggtgctt caaatgaggc gattaccgga aaacaattgc atgatttggc aggcaaattg      6060
     ggtgtgactg tcgataatgc gaaagctgga tttacacaac cgtcctttac caaagtcaat      6120
     tatcaagggc aaacagaaac taacggaaaa accaccttta aagaagcaat caatgatttg      6180
     atcgtggctg tgaataaagg actggtcgta ggcgatggta ctgtaaaagg cacgcttcaa      6240
     ctgggggata ccttgcagat taaagcgggg aatatcgata aaaaatcaac cagtgatgat      6300
     ggatttagta gcgataatat taaaacatca tatcaacaaa atacaaaaga gcttttaatt      6360
     ggcataaaag ataaaccgtc ttttaaacaa gtaacggtca ctgaagaaat aaatgaaaaa      6420
     agtccaaaga ctgccttaac cactaaaaaa tatgtggaca gtaaagcgac tcaaaacgag      6480
     caagcgattg ccaaccaaga gataaaatac aaggctaatg gagcaggtga taataaagtt      6540
     aaactttccg aaggtcttga ttttaaaaat gatgataaca tcactgtcac agcagatgct      6600
     ggcggtgcga ttacgcataa attaaatgcc gatctgaaaa atatcacttc gattgccggt      6660
     aaaggtgaca gtggcacggc tccgaagatt gactttgcaa atggcgatgg tctgaaaatc      6720
     tcttctaaag gaacagatct gacattaaaa gctgatggat tagacttaaa taataagcaa      6780
     atcacaggca ttgcgagtgg tttagatcaa aaaatgaatg gtgctagtgg cagacaagat      6840
     ttagacgagt tgttaaaact tgttgccaca ggacaaccgc aaaatggtgg aacatcaaat      6900
     gatggcaaat taaacaaagc catcaatgca ggcgatttgc ttcatatcgc taatgaattg      6960
     aaaaataaag ggctgtcatt ccaaggaaat gacggtaaag atgtcacacg caaactcggt      7020
     gagacattga aaattgtggg tgaaacatca gcaaccactc caacagatag cacgcaacca      7080
     gcaatggaaa ccgcaccgga caatatcacc gtggcgaaga aaactggcaa tggcgatgac      7140
     accttagaaa ttaaattgtc taaaaactta aaaggtattg cctctattgc caatggcgat      7200
     aaagcaaaaa tcgctttgga taaagataaa gggacgataa cattcaccgc aggcgatcaa      7260
     gcaagatcaa aagatgtcac cctaagtgcg ggtaaattta gcggcgtgtc tgaaattaat      7320
     aaagaagagg gcaaaggtgc gttaaaactc actgaaaaca ctgccacttt agaaagtgcg      7380
     aaagataatt caaaacttga attgaaagat aaagcggtta ccttagaaag tactaaagat      7440
     ggttcaagcg ttactttaga tggcactagt gcaacgttaa gtgcgggtaa aaataagggt      7500
     agtattaaag ttaccaatgg agcggataac aaaattgagt taagtccgga aaacggctca      7560
     accgttatgt tgaaaaaaga catgacaaat ggcggagtgc aagccactgg cttatctacc      7620
     attggcaaag acgatgataa cgctttagtg tttaaaaaca gtacaagtgg cactgataaa      7680
     acagcggagt taaaagtggg tggaagtgca ttgacattta ctaaagccac taccggaaat      7740
     accgtgaaaa tctccaatgt ggaagatgga aaaattgata ctagttcaac cgaagccatt      7800
     acgggtaaac aacttcatga tttagcaagt aaattagggg ttgaagttga gagtgaaact      7860
     ggatttaaac aaccatcatt tactgcaata aaaggcggta caagttcaac tggtggtaca      7920
     actaatagca atacaggtcc tacaactttt aaagaggcta ttaatcagtt aatcaccgca      7980
     gttaatggtg gattgacatt caaggggaat gataatggta gctccccaag ctcaaccaca      8040
     ttacaattag gcggtacgtt gaccattgat agttcaacaa gtaaggtaaa agccgatggt      8100
     atggcagaag ccacacaaaa agacatcacc gtatcattag caccatctaa tggtaacaat      8160
     cctcaaagtg cgggtacact tacgctgaaa ttaaataaag caaccacggt ttctgaaact      8220
     gatgaaaaag tcgtgacttc taaagccgta gcaacaaaat tgaaggaata cacgacaaca      8280
     gcacaattgc aaacagactt cttaaaagtt gatgggtcga atattgggga taaaaaatta      8340
     gctttaggaa aaaatgtcgg tattgacacc atcaaactcg gcgaaactga aaaaagtacg      8400
     actgaattag tccaggcgga tgcggttatt aagtatctaa aaggtacagg tgataaatcc      8460
     gttaaagtat ccgataatcc ggaaactaag gctgatggag agggttctat tgcgattggc      8520
     gataaagcag tagcagaaaa tgaaggggca attgctattg gttatgacac gagtgctaaa      8580
     aatagacgtt cagttgccat aggtcgagaa gctcaggtat tgggtgagca tgctacggct      8640
     atcggctaca aaaataatgt atcgggtaac gattccggtg cattcggtaa agataatgag      8700
     attatcggaa agcattccta tgctgtgggt gcttataaca aaattgaggg cgaccatgtt      8760
     tatgccttgg gttcaaatat tacgacaact aaagatataa caaatgctgt cattttaggc      8820
     aataaatcaa caggtgtatc caatgcggta tctgtaggtg gtgctggcaa agatgaacaa      8880
     agaagaattg tttatgttgc cacaccaact gataaatacg atgccgttaa taagaaatat      8940
     gtggacgact tgacgttatc gtataaaacg aatagtgatg acaaaacgaa gcaatctatc      9000
     aacctcaaaa caggggcttt ggactttaag aagtcagaaa atatttctgt ttctgtagaa      9060
     gctgatggaa aaattacgca tacgcttaat aataatcttc aagaaatcac cagtatcaaa      9120
     ggtggtaaag atgaaagcgg tgcgaaaatc acgttagaaa cagctaaaaa agaaatcagc      9180
     tttaatgatt caaaactcac aaaccttgca gacggtgaaa tcggtgatag ttcaaaagaa      9240
     gccgtaacag gtaaacaact ggcggattta gcgaaacagt taggtattgc ggttgatact      9300
     tcagataaaa cgaaatttac cgcaccaaca tttgataatt tcaaattaaa agacattaat      9360
     ggaacagatg gaactgcacc aaaaaatatc gttgagggct tgaaaaatgc tgtttctaaa      9420
     ctcaacgaag gcttgaagtt cagtgcggat atgccaagtg cggtagcaaa tggcactcaa      9480
     agcacaccgc actatcttgg ttcgaccctt agcattgtgc gtttagatat gaatcaggct      9540
     ggttcgtctg ctacaccagc tccggcgggg acttcatcac aaccaaatat tgctgagttt      9600
     aaaggtgata atttaatcac tcaatacacg agagaagcta acggcaacgc caaaatcgaa      9660
     atcggcttta aaaatgcacc gacatttagc aaagtaatgc ttgctgaaga acaaacatat      9720
     aatggcgtaa atggaaatag cggaagtaca gattggaaaa aagaactcat cactaaaggc      9780
     taccttgaac aagcattaga taagtttaag ttcaaggttg aaaatggtag cggtaagact      9840
     atcgaaatcg gtcgcaacga tacgttgaag tttacgagtg gtcagaatat taaagtagat      9900
     ttagctaaaa acggtacaac accatcaagt acgggatcta ccagtccgag tgcttccgca      9960
     ccggctccaa caccagctgc tccagcatca gtatcatcag cagctccaag cagttcatca     10020
     ggtggtgcag gttcaaacgg cggtggttca aatagtatgg cttcgtcagg tggttcaaat     10080
     ggtgcaggca tggctacgac aacgccaaca agtgcaccaa ctaccacgcc aaccaccact     10140
     accccaacaa caacggcagt ggtaaccatt ggcacgactg aggaactgaa aaacatcact     10200
     tcgatttcct ctaaacctaa agctggaagt gcgggcggaa gcggtacagg ttcaagtgcg     10260
     gttggaaatc aagatgaagt cactaaactg actttagatg cagaaaaagg tgccacattc     10320
     caagttggca atcaaggtac tgaagtaaat atcaataaag atggtatttc acttacacca     10380
     caaagcaaag atggcaaagc aaccttaaac aaagacggct taaccgtggg cgataaagag     10440
     gcagctaacg gcgacaaaac ccataccgtt tatggtaaag acggcttgac tgtaaaaggc     10500
     aaagacagtt caaaagaagt cgtgagcttg aaagtagctg acggtgaaaa cagtcaaggc     10560
     aataatggtg gtaacggtca atccgctacc cttgcgtttg caaaaatcgg aaatggaagc     10620
     ggagctggaa caggtgctga tgcaaaaggc acaggcaccg gcaaaatcac cggtcttgct     10680
     gatattaaac cagatgaaaa agacggcacc cttgcaacca acaaaaacta tgtcgatggc     10740
     aaagtgtccg acttgaacaa taatcgcccg tttgatttct atctgaatgg cgaaaaagtc     10800
     gtgaaagata aagatggtaa tttcaaaaaa ttaaaagacg gtaaacctga tcaactactt     10860
     actgaggaag agaagaaaca agtcgtgatt aaagccgaac caagcaccgc acctatcggg     10920
     attagcaatg tggcaagcgg tttgggtatt acaacaccaa caaaagatga gaaaaaacaa     10980
     cttagtgaac ttgctgagaa agtgaatgag aaagtggaag cattaggcga aaaagcaaaa     11040
     acactttctg atacagcaac aaaactcgct gatttagaat taatggtgga cagtttaaaa     11100
     caaaccattg ataccctgcc tgatggagaa gcgaaagaga aaattcgtga gaatttgaaa     11160
     aaatacgaaa cgcaattatc agatgcccaa gaggctaaaa agaatgccga agaagccgta     11220
     gaatcggcac gcaacgagtt aattgaagca aatggggact ataacgcctt ttccgaggcg     11280
     atggcaaaag tcgaagaact ggttgaaccg gatagccaag ctaatttaag caatgtcgct     11340
     accgttggcg atttacaagc cgtggcacga gcggggctga attttgtcgg taatgatgat     11400
     gtaaccgtgc ataaaaatgt aggtgaaacc ctgtctatca caggcgaggg aacatttaac     11460
     agcaaccgca ctgctaccgg caatatcaaa gtggaaatgg cacaagacgg caaaggctta     11520
     gaagttaaat tgtccgatca gttgaaaaat atgacctctt ttgaaacccg tgaagttgag     11580
     ggtagaaaat ctactttaga cagcaacggc ttgagagtgg tcaataaagg caaagatggc     11640
     actgatgata aagccaaatc tgcaacttat ggagcggaag cggtggtgtt ggaagataaa     11700
     aacaaaagcg ataaggctgt gataaccgca ggtggtatcc gttttgcgga cagttcaacc     11760
     caaacgaccg cactaagtac cgagctgaac aaaaacggat tgacagtgaa cggtgcaggc     11820
     ggtcagattc acattgatgg tacaaaaggg gttatcaccg tgccgaatat taaacctaat     11880
     gcagatggtc atgtggtagt aaacaaaaac tacgtggata ccaaaaacaa tgaactgcgg     11940
     acacaaatga acaataatga tcgcaatatg cgtgcgggtg tggcacaagc tgttgcacaa     12000
     gcgaacttac cgatcaatat attaccaggt aagagtacgt taagtttggc gaccggtaac     12060
     tatatgggga gtcaagcctt tgcggtaggt tattccagag tgtccgataa cggcaaactt     12120
     agcgttaagt tcagcttagg acatggcgat aagaaaactt ctgtgggtgc gggagttggt     12180
     tatagctggt aa                                                         12192
//

If you have problems or comments...

PBIL Back to PBIL home page