(data stored in ACNUC7421 zone)

EMBL: CP000947.PE78

CP000947.PE78        Location/Qualifiers
FT   CDS_pept        complement(89145..89384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0078"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmu:673901 hypothetical protein LOC673901"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32451"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV36"
FT                   /protein_id="ACA32451.1"
FT                   /translation="MYITYHRNKMSLQPTAYSLQPTAYSLQPTAYSLQPTAYSLQPTAY
FT                   SLQPTAYSLQPTAYSLQPTAYSLQPTAYSLQPTA"
     ttgtacatta catatcacag gaataaaatg agcctacagc ctacagccta cagcctacag        60
     cctacagcct acagcctaca gcctacagcc tacagcctac agcctacagc ctacagccta       120
     cagcctacag cctacagcct acagcctaca gcctacagcc tacagcctac agcctacagc       180
     ctacagccta cagcctacag cctacagcct acagcctaca gcctacagcc tacagcctag       240
//

If you have problems or comments...

PBIL Back to PBIL home page