(data stored in ACNUC7421 zone)

EMBL: CP000947.PE79

CP000947.PE79        Location/Qualifiers
FT   CDS_pept        complement(89441..90190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0079"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hso:HS_0210 polar amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32462"
FT                   /db_xref="GOA:B0UV37"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV37"
FT                   /protein_id="ACA32462.1"
FT                   /translation="MIKIRNIHKTFDNNPVLRGIDLDIEKGQVVVILGPSGSGKTTFLR
FT                   CLNALELPEQGTIEFHKENPLYIDFTDKHIRKNILPLRKKSGMVFQQYNLFPHKTALEN
FT                   IMEGPVQVQQRKPDEVRQEAETLLCKVGLIDKANLYPHQLSGGQQQRVGIARALAIRPE
FT                   LMLFDEPTSALDPELVQDVLNTMKGLANEGWTMVVVTHEIKFALDVADVVVVMDKGIIV
FT                   EQGSPKTLFENPQHERTKAFLHQIRFN"
     atgattaaaa ttcgtaatat tcataaaaca tttgacaata atcctgtatt acgtggaatt        60
     gatttagata tagaaaaagg tcaagttgtt gtcatcttag gaccatcagg ttcaggtaaa       120
     acgacttttt tacgttgttt aaatgccctt gaattaccgg aacaaggcac aatcgaattt       180
     cacaaagaaa atccgctgta tattgatttt acggacaaac acattcgcaa aaacatttta       240
     ccgctacgca aaaaatcagg catggtattc caacaatata atttatttcc acataaaacc       300
     gcattagaaa atatcatgga aggacctgtt caagtacaac aacgcaagcc tgatgaagta       360
     cgccaagaag cggaaacatt attatgtaaa gtagggctaa tagacaaagc taatctctat       420
     ccacaccaac tttctggcgg gcaacaacag cgagttggta ttgcacgagc tttagctatt       480
     cgacctgaat taatgctgtt tgatgaacct acctcagcac tggatcctga attagttcaa       540
     gatgtattaa acacgatgaa agggcttgct aacgaaggtt ggacaatggt cgtagtcacg       600
     catgaaatca aatttgcttt agatgtggca gatgtagtgg tcgttatgga taaaggcatt       660
     attgtggaac aaggatcgcc aaaaacgtta tttgaaaacc cacaacatga acgcactaaa       720
     gccttcttac atcaaatcag atttaactaa                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page