(data stored in ACNUC7421 zone)

EMBL: CP000947.PE8

CP000947.PE8         Location/Qualifiers
FT   CDS_pept        complement(5922..7148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0008"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein; KEGG: hso:HS_0143 coenzyme A biosynthesis
FT                   phosphopantothenoylcysteine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32471"
FT                   /db_xref="GOA:B0UUW6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUW6"
FT                   /protein_id="ACA32471.1"
FT                   /translation="MQNLIRGKRIVIGITGGIAAYKTIELIRLLRKAQAEVRVVLTNAA
FT                   TEFVTPLTLQAISGNAVSQSLLDHEAELAMGHIELAKWADLIVIAPASADFIARMAVGM
FT                   ANDLLSTICLATNSPIFLAPAMNQQMYAQTVTQQNLAQLMARGVQFIGPNSGEQACGDV
FT                   GIGKMSEPFEIFTALCQSFLHTQDLLDVSVVITAGPTREAIDPVRYISNHSSGKMGFAI
FT                   AEAFAQRGAKVTLISGPVNLATPHNVQRINVVSAQEMYQHAIQSAEQNQIFIGCAAVAD
FT                   YRVEQIAEQKIKKIPGNDEMVLKLVKNPDILATVANLMENRPFVVGFAAETQNVEQYAK
FT                   DKLQRKNLDMICANDVSGGQVFNSEQNALQLFWQNGQERLTLKHKSDLAKQLVDKIIVR
FT                   YKWKLEESK"
     atgcaaaatc ttattcgggg aaaacgaatt gtcattggaa ttaccggcgg tattgctgca        60
     tataaaacca tagaattaat tcgtttattg cgtaaagcac aagcagaagt tcgagtagtg       120
     ctaacaaatg cagcgacaga atttgtaaca cctttaactt tacaagcaat ttccggcaac       180
     gctgtatcac aatctttact tgatcatgaa gctgaattgg caatgggaca tattgaattg       240
     gctaagtggg cggatcttat cgtaattgca cctgccagtg cagactttat tgcacgcatg       300
     gcggtcggta tggcaaacga tttattatcc actatttgtc tagcaacgaa ttctccaatt       360
     tttctggctc cggcaatgaa ccaacaaatg tatgcacaaa ctgttactca acaaaattta       420
     gcacaactca tggctcgtgg tgtgcagttt atcggaccga atagtggtga acaggcttgt       480
     ggtgatgtag gtatcggaaa aatgtcagaa ccttttgaaa tttttaccgc actttgccaa       540
     tcctttttac atactcaaga tttacttgat gtaagtgttg tgattaccgc aggtccaaca       600
     agagaagcca ttgatccggt acgctatatt agtaatcata gctcaggcaa aatggggttt       660
     gctattgctg aagcttttgc tcaacgaggt gcaaaagtca ctttaatcag tggacctgtc       720
     aatttagcga cacctcataa tgtacaacgc attaatgtag tttcggcaca agaaatgtat       780
     caacatgcaa tacaaagtgc ggaacaaaat cagattttta ttggttgtgc agcggtagct       840
     gattatcgtg tagaacaaat tgcagaacaa aaaattaaga aaatccccgg taatgatgaa       900
     atggtcttaa agttggtcaa aaatccagac attcttgcaa ctgtagccaa tttaatggaa       960
     aatcgtcctt ttgttgtagg atttgcggct gaaacacaaa atgtggagca gtatgcgaaa      1020
     gacaaattac aacgtaaaaa tttggatatg atttgtgcaa atgatgtttc cggtgggcaa      1080
     gtatttaatt cagagcaaaa cgcattgcag ctgttttggc aaaatgggca agagaggttg      1140
     acattgaaac ataaaagtga cttagctaaa caattggttg ataaaattat tgtgcgttat      1200
     aaatggaaat tggaagaaag taaatga                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page