(data stored in ACNUC7421 zone)

EMBL: CP000947.PE80

CP000947.PE80        Location/Qualifiers
FT   CDS_pept        complement(90204..90935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0080"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: hso:HS_0211 amino
FT                   acid ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32472"
FT                   /db_xref="GOA:B0UV38"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV38"
FT                   /protein_id="ACA32472.1"
FT                   /translation="MVEISVLNNFLASLPFMTEARAELVINGFFPMVKAAVLVSIPLAI
FT                   VSFILGMVIAIAVALIRVSPSHSIIHRLFLFITKIYISIIRGTPMLVQISIVFYGLPAL
FT                   GIFIDPIPAAIIGFSLNVGAYASETVRAAIQSVPKGQWEAGYTIGMTYMQTFRRIIVPQ
FT                   AFRVAVPPLSNTFISLFKDTSLASVVTVTEMFRVAQQVANMSYDFLPVYIEAALIYWCF
FT                   CFILFLWQARIEKKLARYVTR"
     ttggtagaga tatcagtgtt aaataatttc cttgcctcat tgccttttat gactgaggca        60
     agagcagaat tagtcatcaa tggatttttt cccatggtca aagcggcggt attagtttca       120
     ataccgcttg ctatcgtatc atttatattg ggaatggtta ttgcgattgc tgttgcgtta       180
     attcgagtga gtccaagcca tagcattatc catcgcctct ttttatttat aacaaaaatt       240
     tatatttcaa ttattcgtgg gacaccaatg ctagtgcaaa tatccatcgt tttttatgga       300
     ttacctgcac tggggatttt tattgatcct attcctgccg caattatcgg tttctcatta       360
     aatgtcggtg cttatgcttc tgaaacggta cgagcggcga tacaatccgt ccccaaagga       420
     caatgggaag ccggttacac aatcggcatg acttatatgc aaactttccg ccgaattatt       480
     gtaccgcaag catttcgtgt tgccgttcca cctctgagta atacatttat cagtttattc       540
     aaagacactt ctttagcttc ggtagtaaca gtaacggaaa tgttccgagt ggcacaacaa       600
     gtagcaaata tgtcttacga tttcttaccc gtttatattg aggcagccct gatttattgg       660
     tgtttctgtt ttatcttgtt cttatggcaa gctcgcatag aaaaaaaact tgctcgttat       720
     gttactcgct aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page