(data stored in ACNUC7421 zone)

EMBL: CP000947.PE81

CP000947.PE81        Location/Qualifiers
FT   CDS_pept        complement(90910..91692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0081"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: hso:HS_0212 amino acid ABC transporter,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32483"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV39"
FT                   /protein_id="ACA32483.1"
FT                   /translation="MLKKITFLFTTVFAIVANTQALAQASLLDRINNKGTITVGTEGTY
FT                   APFTYHDSTGKLTGYDVEVTRAVAKKLGVTVEFKETQWDAMLAGLKAGRFDLVANQVAL
FT                   TTPERQATFDKSEPYSWSGAMLVARDNETRIKQVEDVKGLKAAQTLSSNYGELAQKYQA
FT                   KIVPIDGMAQGLLLIQQKRADMTFNDALALLDYLKKYPNSGLKPVWESKDKVGAGLIVN
FT                   KNNDEALAKISAAIEELRNDGTLKQLGEQFFGRDISVK"
     atgttgaaaa aaataacatt tttattcact accgtttttg caatagtcgc caacacacaa        60
     gccttagcac aggcgagttt attagatcgc attaacaaca aaggaacgat tacggtcggt       120
     acggaaggca cttacgcacc gttcacttac cacgactcaa ccggaaaatt gacaggatat       180
     gatgttgaag tgactcgtgc agtagctaaa aaattaggtg taaccgttga atttaaagaa       240
     acacaatggg atgcgatgct tgctggttta aaagctggac gttttgattt ggtagcaaac       300
     caagtcgcat taacaacacc tgaacgtcaa gccacttttg acaaatctga accttatagt       360
     tggtccggag caatgttagt agcacgagat aatgaaactc gcattaaaca agttgaagat       420
     gtaaaaggct taaaagcagc acaaacactt agctcaaact atggtgaatt ggcacaaaaa       480
     taccaagcta agattgttcc tattgacggc atggcacaag gcttattact catacaacaa       540
     aaacgagcag atatgacgtt taacgatgca ctagccttat tggattattt gaaaaaatac       600
     ccaaattcag gtttaaaacc ggtatgggaa tctaaagata aagtgggtgc gggtcttatt       660
     gtcaataaaa ataatgatga agcactagca aaaatcagtg cagctatcga agaattacgc       720
     aacgatggca cattaaaaca attaggtgaa caattctttg gtagagatat cagtgttaaa       780
     taa                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page