(data stored in ACNUC7421 zone)

EMBL: CP000947.PE82

CP000947.PE82        Location/Qualifiers
FT   CDS_pept        92084..92572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hso:HS_0218 Haemophilus-specific protein,
FT                   uncharacterized"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32494"
FT                   /db_xref="GOA:B0UV40"
FT                   /db_xref="InterPro:IPR025911"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV40"
FT                   /protein_id="ACA32494.1"
FT                   /translation="MTMNDKLKLYRVTDHYLDFLRDVEPKIPMNKDNGKKRPFVGIVLS
FT                   INGVKYIAPLSSKICKSQSDFKVKSGGEQKATIRFAYMFPIVDSALIEIDYTEEFKIDF
FT                   KYTALLIKEDLYINQHKARIHEIATKTYTNAITKRFGFENFCCDFAKLEEKHRAYEAQ"
     atgacgatga atgacaaatt aaaactatat cgtgtaacgg atcactatct tgatttttta        60
     agagatgttg agcctaaaat cccaatgaat aaagataatg gaaaaaaacg cccttttgtt       120
     ggcattgttc tttccattaa cggcgtaaaa tatatcgccc ctttatcttc taaaatttgc       180
     aaaagccaaa gcgattttaa agtgaaaagt ggcggtgaac aaaaggcgac tattcgattt       240
     gcgtatatgt tccccattgt tgatagtgct ttaattgaga ttgattatac cgaagaattt       300
     aaaatagatt ttaaatatac ggcattgctc atcaaagagg acttatacat caatcaacat       360
     aaagcacgta ttcacgaaat tgcaaccaaa acgtatacta atgcaatcac aaaacgtttt       420
     gggtttgaaa atttctgttg cgactttgca aaactggaag aaaaacatcg agcttatgaa       480
     gctcagtaa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page