(data stored in ACNUC7421 zone)

EMBL: CP000947.PE86

CP000947.PE86        Location/Qualifiers
FT   CDS_pept        95866..96588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0086"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   hso:HS_0222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32534"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV44"
FT                   /protein_id="ACA32534.1"
FT                   /translation="MSKFLLHLTPIAIIHTPYKEKFSVPRQANLVQDGTGIVELLPPFN
FT                   CPEAVRGLEQFSHLWLIFQFDNVPTGKWQPTVRPPRLGGNKRIGVFASRSTHRPNPLGL
FT                   SKVELREVEYKNGKILLHLGSVDLIDGTPILDIKPYIAYADNEPNARSGFAQEKPKQEL
FT                   RVEFSPEVQATLEKLEKKRPHLKRFIREVIQQDPRPAYQKGKCFHKIYGIALYEFNIRW
FT                   RIKNDDFTVAEVIEIQNI"
     atgtctaaat ttttacttca tcttacgccg attgcaatca ttcatacgcc gtataaagaa        60
     aaattttccg tccctcggca agcgaattta gttcaagacg ggacaggtat tgtggagttg       120
     cttccgccgt ttaattgtcc ggaggctgta cgtggactgg agcagttttc tcatttgtgg       180
     ttaatttttc aatttgacaa cgtgccgaca ggtaaatggc aacctacagt acgacctccc       240
     cgtttaggag gtaataagcg tattggtgtt tttgcttcca gatcgacaca tcgccctaat       300
     cctttggggt tatctaaagt ggaacttcgt gaagttgaat ataaaaacgg aaagattttg       360
     ttacatctcg gttcagtcga tttgattgac ggtacaccaa ttttagatat taaaccttat       420
     attgcctatg cggataatga acctaatgca agatcgggat ttgcccaaga aaagccaaag       480
     caggaattgc gagtggaatt tagtcctgag gtgcaggcaa cactggaaaa actggaaaaa       540
     aaacgaccgc acttgaagcg ttttattcga gaagttattc agcaagatcc cagacctgcc       600
     tatcagaaag gaaagtgttt tcataaaatt tatggcattg cactgtatga atttaatatt       660
     cgttggagaa ttaaaaatga tgattttaca gtggcggaag tgatcgaaat tcagaatatt       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page