(data stored in ACNUC7421 zone)

EMBL: CP000947.PE87

CP000947.PE87        Location/Qualifiers
FT   CDS_pept        96870..98171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2532 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32545"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV45"
FT                   /protein_id="ACA32545.1"
FT                   /translation="MKRTILHALQKWKEKPNRKPLIIQGARQVGKTWVMKHFGEQAFAK
FT                   VAYINFDNNPRMKSLFAGDYDIQRLLLGLKIESGVDIQAEDTLIIFDEIQEAPQALSSL
FT                   KYFYENAPQFYIMAAGSLLGVSLHHQVSFPVGKVDFLPLYPMDFYEFLTALGKQDLVEL
FT                   LELQDWILISAMKSRYIDLLRQYYFVGGMPEAVKTFVQTQNLDEVRQVQRNLLMAYEQD
FT                   FSKHIQDGHTVQRVRALWHAIPEQLAKENKKFVYSLLQKGARSKDYELALQWLKDSGLV
FT                   HLVPRIKKPHLPLSAYQDGAFKLFGLDVGLLTAQTHLDKSVLLEGNRLFTEFKGALTEQ
FT                   YVLQQLIASQENPVFYWATERGTAEVDFVLQYKQAVIPIEVKAEENLKAKSLKVYVEQF
FT                   QSEKAIRFSMADYREQDWMVNVPLYVVKNMFFKI"
     atgaaacgaa caattcttca cgcattgcaa aaatggaaag agaaaccgaa ccgtaagcca        60
     ttgattattc agggagcaag gcaggttgga aaaacgtggg tgatgaaaca ttttggtgag       120
     caggcttttg ctaaggtagc ctatatcaac tttgataaca acccccgaat gaaaagcctg       180
     tttgccggcg attatgacat tcaacgcctg cttttagggc tgaaaattga aagtggagta       240
     gatattcagg cagaagatac actgattatt tttgatgaaa ttcaggaagc accacaagca       300
     ctttcttcgc ttaaatattt ttacgaaaat gcaccgcagt tttacattat ggcggcgggt       360
     tcgttacttg gcgtatcgct acatcatcaa gtctcctttc ccgtcggcaa ggttgatttt       420
     ctgcctcttt atccgatgga tttttacgaa tttttaaccg cacttggcaa gcaagattta       480
     gtggaactat tggaattgca agactggata ctgatttctg cgatgaaaag ccgttatatc       540
     gatctgctca ggcaatatta ttttgttggt ggaatgccgg aagcggtcaa aacctttgtt       600
     caaactcaaa atttagatga agttcgccaa gtgcaacgca atttgttgat ggcgtatgaa       660
     caggattttt ccaagcatat tcaagacgga catacagtgc aacgggtgcg ggcgttatgg       720
     cacgcaattc ccgagcaact tgccaaggaa aataaaaaat ttgtgtattc tctgttgcaa       780
     aaaggggcaa gaagtaagga ttatgaactt gctcttcaat ggctgaaaga tagcggtttg       840
     gtgcatttag tccctcgtat taaaaagcct catttgccgc tttctgctta tcaagatggt       900
     gcgtttaaat tgttcggatt ggatgtcgga ctattgacgg cacaaactca tttggataaa       960
     agcgttttat tggaaggcaa tcgcctattt actgaattta aaggtgcact aactgaacaa      1020
     tatgtacttc aacaactgat tgcaagccaa gagaatccgg tattttattg ggcgacagag      1080
     cgaggtaccg ccgaggtcga ttttgtactg caatataaac aagcggttat tccgattgaa      1140
     gtaaaagccg aagaaaatct gaaggctaaa agtttgaaag tctatgttga acaattccaa      1200
     agcgaaaagg caatccgatt ttcaatggcg gattaccgag agcaggattg gatggtgaat      1260
     gtgccgttgt atgtggttaa aaatatgttt tttaaaattt aa                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page