(data stored in ACNUC7421 zone)

EMBL: CP000947.PE88

CP000947.PE88        Location/Qualifiers
FT   CDS_pept        98140..98292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hso:HS_0222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32556"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV46"
FT                   /protein_id="ACA32556.1"
FT                   /translation="MWLKICFLKFKGILFMHKIYGMALYEFNIRWRIKHDDDVTVAEVI
FT                   HIQHV"
     atgtggttaa aaatatgttt tttaaaattt aaaggcattt tatttatgca taaaatttat        60
     ggtatggcac tgtatgaatt taatattcgt tggagaatta aacatgatga tgatgttaca       120
     gtggcggaag tgattcacat tcagcatgtt tga                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page