(data stored in ACNUC7421 zone)

EMBL: CP000947.PE89

CP000947.PE89        Location/Qualifiers
FT   CDS_pept        98452..98871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0089"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG: hso:HS_0223 high
FT                   affinity ribose transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32567"
FT                   /db_xref="GOA:B0UV47"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV47"
FT                   /protein_id="ACA32567.1"
FT                   /translation="MKKTKLLNASLSHYIATLGHTDSLVICDAGLPISNQVERVDLALE
FT                   AGVPGFLQTVDVVISEMFVEHAVVAKEIREKNPQIHDALLDSLRKLSEQQGNCIAVEYV
FT                   EHEEFKVLSSESKAAVRTGEFSPYANIILYSGVPF"
     atgaagaaaa caaaattatt aaatgcgagc ttatcacatt atattgcaac gttaggccat        60
     acagacagtt tggttatttg tgatgccgga ttgcctattt caaatcaagt tgaacgtgtt       120
     gatttagcgt tggaggcagg cgttcccggc tttttacaaa ctgttgatgt ggttataagt       180
     gagatgtttg tggagcatgc cgttgtggcg aaagaaatta gagaaaaaaa tccgcaaatt       240
     catgacgcac ttttagattc gttaagaaaa ttatcagaac aacaaggcaa ctgcattgcc       300
     gttgaatatg tggaacatga agaatttaaa gtattaagtt ctgagagtaa agctgctgta       360
     cgtacagggg aattctcgcc gtatgctaat attattttgt attcaggtgt gccattttaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page