(data stored in ACNUC7421 zone)

EMBL: CP000947.PE9

CP000947.PE9         Location/Qualifiers
FT   CDS_pept        7321..7989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0009"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: hso:HS_0144 DNA
FT                   repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32578"
FT                   /db_xref="GOA:B0UUW7"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUW7"
FT                   /protein_id="ACA32578.1"
FT                   /translation="MTQQNTTLMPREKLLKYGASSLDDKELLAIFLRTGIKNCPVMQLS
FT                   ELVLAHFSSLRGLINADQKHFCQMKGLGITQFVQLQACTEMTKRYLLQELQFAQEFTSP
FT                   DTVRMYLQTELENKDREIFMVLFLDNQHRLIKKEEMFLGTINQANVYPREIIKTALFCN
FT                   AAALILAHNHPSGVSTPSMADRKMTENIKQLSELMEIRVLDHFIIGKGNYFSFAEQGWI
FT                   "
     atgacacaac aaaatacaac tttaatgccg agagaaaaac tactgaaata tggagcttca        60
     tcacttgatg ataaggaatt attagcgatt ttcttacgta caggtataaa aaattgtcct       120
     gttatgcaac tctccgagtt ggtacttgct catttttctt ctttaagagg attaattaat       180
     gcagaccaaa agcatttttg ccaaatgaaa ggattgggta ttactcaatt tgtacaatta       240
     caagcctgta ctgaaatgac caaacgttat ctcttacaag aattacagtt tgcacaagaa       300
     tttaccagcc ctgatacggt tcgtatgtat ttacagactg aattggaaaa taaagataga       360
     gaaattttta tggtactgtt tttggataat caacatcgtt taataaaaaa agaggaaatg       420
     tttttaggta ccattaacca ggcaaatgtt tatcctcgtg agattattaa aaccgcacta       480
     ttttgtaatg cagccgcact tattcttgca cataatcatc cttccggtgt ttcaacgcca       540
     agcatggcag acagaaaaat gaccgagaat ataaaacaac tatcagaatt aatggaaatc       600
     cgtgttttag atcattttat cattggtaaa ggtaactatt tctccttcgc agaacaaggc       660
     tggatctag                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page