(data stored in ACNUC7421 zone)

EMBL: CP000947.PE90

CP000947.PE90        Location/Qualifiers
FT   CDS_pept        98892..100385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0090"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hin:HI0502 D-ribose transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32579"
FT                   /db_xref="GOA:B0UV48"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV48"
FT                   /protein_id="ACA32579.1"
FT                   /translation="MQVETLLKITGVDKSFPGVKALSNACLSVYAGRAMALMGENGAGK
FT                   STLMKVLTGIYSKDSGSIEYLGDVVNFKGPKDSETAGISIIHQELNLVANLTVAENIFL
FT                   GREFTTSWGAIDWKKMYREADKLLAHLGVSFRSDQLCSELSIGEQQMVEIAKALSFKSK
FT                   VIIMDEPTDALTDTETETLFNVIRELKEQHCGIVYISHRIKEIFEICDDVTVLRDGQFI
FT                   GESAVQDLTEERLIEMMVGHRLEEQYPHVEQDRGSVRLEVNQLFGSGICDVSFKLYSGE
FT                   ILGVSGLMGAGRTELMKVLYGALPKEEGEVRLNNKVISNDSPQDGLRNGIVYISEDRKG
FT                   DGLILGMSVKENMSLTALDHLSKAGKINHQAEKMVVDDFIELFNIKTPNREQQIGLLSG
FT                   GNQQKVAVAKGLMTRPDVLILDEPTRGVDVGAKKEIYQLINKFKQEGLSIILVSSEMPE
FT                   VLGMSDRILVMHEGRISAEFSREEATQGKLLAAALGKHN"
     atgcaagtgg aaaccttgct caaaattacc ggtgtagata aatcttttcc gggtgttaaa        60
     gcacttagta atgcttgttt atctgtttat gcgggacgag caatggcact tatgggagaa       120
     aatggtgcag gtaaatcaac gttaatgaag gttttaaccg gaatttatag caaagatagc       180
     ggttctattg aatatttagg agatgttgtc aattttaaag gacctaagga ttctgaaacg       240
     gcaggaatta gtattattca ccaagaactg aatttagttg caaatttaac cgttgctgaa       300
     aatatttttt tggggcgtga atttacaacc tcttggggtg caattgattg gaagaaaatg       360
     tacagagagg ctgataaatt attagcacat ttgggtgtgt catttcgcag tgatcagctt       420
     tgttcggaat tgtctattgg tgaacaacaa atggttgaga tagcaaaagc gttgagcttt       480
     aaatcaaaag tgatcattat ggatgagccg acagatgcct tgacagatac ggaaacggaa       540
     acgcttttta acgttattcg tgaattaaaa gaacaacatt gtggcattgt atatatttct       600
     catcggatca aagaaatttt tgaaatttgc gatgatgtaa cagtattacg tgatggacag       660
     tttattggtg aaagtgcggt gcaagatctc acggaagagc gtttaatcga gatgatggtt       720
     ggccaccgtt tagaggagca atatccgcat gttgaacaag atcgtggttc tgttcgtttg       780
     gaagtaaatc agcttttcgg tagcggaata tgtgatgtga gctttaaact atatagtggt       840
     gagattttag gtgtgtcagg cttaatgggt gccggtagaa ctgaattgat gaaagtgcta       900
     tatggtgctt tgcctaaaga agaaggtgaa gtgcggttaa ataataaagt catttctaat       960
     gattctcctc aagacggttt aagaaacggt attgtatata tttctgaaga tcgtaaaggc      1020
     gacggactaa ttttgggtat gtctgtaaaa gaaaatatgt ctttgaccgc cttggatcat      1080
     ttgtcaaaag ccggaaaaat taatcatcaa gcagaaaaaa tggtggtaga tgattttatt      1140
     gagttgttca atattaaaac cccaaaccgt gaacagcaaa taggcttgct ttctggcggc      1200
     aaccagcaaa aagtggcagt tgctaaaggg ctaatgactc gtcctgatgt acttatttta      1260
     gatgaaccga ccagaggcgt tgatgttggt gcgaaaaaag aaatctatca attgattaat      1320
     aaatttaaac aagagggatt aagtattatt ttggtttcat ctgaaatgcc ggaagtactt      1380
     gggatgagtg atcggatttt agttatgcac gaaggtcgta ttagtgctga atttagtcgt      1440
     gaagaggcaa cacaaggaaa attacttgcc gcagcactcg ggaaacataa ttaa            1494
//

If you have problems or comments...

PBIL Back to PBIL home page