(data stored in ACNUC7421 zone)

EMBL: CP000947.PE91

CP000947.PE91        Location/Qualifiers
FT   CDS_pept        100395..101354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0091"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   hit:NTHI0631 ribose transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32590"
FT                   /db_xref="GOA:B0UV49"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV49"
FT                   /protein_id="ACA32590.1"
FT                   /translation="MKSSFKLGKMLLEQRSVIALLILIAIVSMINPDFFSIDNILNILR
FT                   QTSINAIIAVGMTFVILIAGIDLSVGSILALTGAVAASLVSMELSIFMVIPLTLLLGTF
FT                   LGSVSGFIVAKGKVQAFIATLVTMTLLRGVTMVYTEGRPISTGFSETADSFAYLGTGYL
FT                   LGIPLPIWLMVIVFAVAWYVLKHCKIGRYIYALGGNENATQLSGINVNRIKIFVFAVSG
FT                   FLSALAGLIVTARLSSAQPTAGVSYELDAIAAVVVGGTSLMGGKGRVMGTLIGALIIGF
FT                   LNNALNLLDVSSYYQMIAKALVILIAVLADNYLGNKKA"
     atgaaatcat catttaaatt gggaaaaatg ttattagagc aacgttcagt tattgctctg        60
     ttgatactta ttgctattgt atcaatgatt aatcctgact ttttcagtat tgataatatt       120
     cttaatatct tacgtcaaac gtcgataaat gcgattattg cagtaggtat gacttttgta       180
     attttgattg cagggattga tttatccgtc ggttctattc ttgcgttgac cggtgcggtt       240
     gccgcttcat tagttagcat ggagttatcc atttttatgg ttattccgtt aacgctatta       300
     ttggggactt ttttgggtag cgtaagcggt tttatcgttg caaaaggcaa agtacaggca       360
     tttattgcca cattagttac catgacttta ttacgtggtg tgacaatggt ttatactgaa       420
     ggtcgtccga ttagtacggg attttctgaa acggcagaca gctttgctta cttaggtaca       480
     ggttatttat tgggtattcc tttgccgatt tggttaatgg taattgtatt tgcggttgct       540
     tggtatgttt taaaacactg taaaatcgga cgctatattt atgctttagg cggtaatgaa       600
     aatgcaacgc agctatcagg cataaatgtt aatagaatta aaatatttgt gtttgcagtg       660
     agcggttttt tatccgcact tgccggattg atcgtcactg cacgtttatc ttcagcacaa       720
     ccgacagccg gtgtgtctta tgaattagat gcgattgccg ccgtcgttgt cggcggaacc       780
     agtttaatgg gcggtaaagg tcgtgttatg ggtacattaa tcggtgcatt gattatcggt       840
     tttttaaata atgcactgaa tttattagat gtttcatctt actatcaaat gatagcaaaa       900
     gcgttggtta tcttaattgc ggtgcttgcg gataactatt taggtaataa aaaagcataa       960
//

If you have problems or comments...

PBIL Back to PBIL home page