(data stored in ACNUC7421 zone)

EMBL: CP000947.PE92

CP000947.PE92        Location/Qualifiers
FT   CDS_pept        101383..102261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0092"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: hit:NTHI0632
FT                   ribose-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32601"
FT                   /db_xref="GOA:B0UV50"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV50"
FT                   /protein_id="ACA32601.1"
FT                   /translation="MKKLTTIASAVMLSLAFSGVAMAKETIALAVSTLDNPFFVSLKDG
FT                   AQKKADELGYKLVVLDSQNDPAKELANVEDLMVRGAKVLLINPTDSEAVSNAVAIANRR
FT                   NVPVITLDRGAAKGKVVSHIASDNVAGGKMAGDFIAQKLGANAKVIQLEGIAGTSAARE
FT                   RGEGFKQAIAEHKFDVLASQPADFDRTKGLNVMENLLASKSAVQAVFAQNDEMALGALR
FT                   AINAANKKVLVVGFDGTDDGVKAVKSGKLGATIAQQPELIGSLGVETADKVLKGETVAE
FT                   KIPVDLKVIVK"
     atgaaaaaat taacaactat tgcatcagct gtcatgttaa gtcttgcttt tagcggtgta        60
     gcaatggcaa aagagacaat tgcattagca gtgtcaactt tagataaccc attttttgta       120
     tcacttaaag acggtgcaca gaaaaaagcg gacgaattag gttataaatt agttgtgtta       180
     gattcgcaaa atgaccctgc gaaagagctg gctaatgttg aagatttaat ggttcgtggt       240
     gcaaaagtat tattgatcaa tccaacagac agcgaagcag tttcaaatgc ggttgctatt       300
     gccaatcgtc gcaatgttcc tgtcatcact ttagatcgtg gagcggcaaa aggtaaggta       360
     gtgagccata tcgcttcaga taatgtagct ggcggtaaaa tggcaggtga ctttattgca       420
     cagaaattgg gtgcaaatgc aaaagttatt caacttgaag gtattgcggg tacatctgca       480
     gcacgtgagc gtggcgaggg tttcaaacaa gctattgcag aacacaaatt tgacgtatta       540
     gccagtcagc cggctgattt cgatcgtact aaaggcttaa acgttatgga aaatttatta       600
     gcaagtaaat ccgcagttca agctgtattt gcacaaaatg atgaaatggc attgggagcg       660
     ttacgtgcta ttaatgcggc taataaaaaa gtactggtag tcggttttga tggcactgat       720
     gatggtgtta aagctgttaa aagcggtaaa ttaggtgcaa ctattgcaca acaaccggaa       780
     cttatcggta gtttaggcgt tgaaactgct gataaggtat tgaaaggtga aaccgtcgca       840
     gagaaaattc ctgttgactt aaaagtcatt gttaaataa                              879
//

If you have problems or comments...

PBIL Back to PBIL home page