(data stored in ACNUC7421 zone)

EMBL: CP000947.PE93

CP000947.PE93        Location/Qualifiers
FT   CDS_pept        102345..103298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0093"
FT                   /product="ribokinase"
FT                   /note="TIGRFAM: ribokinase; PFAM: PfkB domain protein;
FT                   KEGG: hso:HS_0225 ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32612"
FT                   /db_xref="GOA:B0UV51"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV51"
FT                   /protein_id="ACA32612.1"
FT                   /translation="MSKTLTVLGSINADHVISVPHFAKPGETLSGKQYHIAYGGKGANQ
FT                   AVAAARLADFSQGATVNFVGCIGSDDIGRAMKKAFAQDGINVATITEIPNEMTGIAMIQ
FT                   VADSGENSIVISAGANAYLTPEIVDKFATEIERADYLLMQLETPLNAILEAAKLAKKHG
FT                   ATVVLNPAPANQLPDELLSLLDMITPNETETEILTGVKVTDEQSAAKAASVLHQKGVAT
FT                   VLITLGSKGVYVSRKSSTQELGQNKVIAGFRVNAVDTTAAGDTFNGAFLTALLENKSLD
FT                   EAIRFAHAAAAISVTRQGAQPSIPTRRETLDFLAQH"
     atgagcaaaa ctcttactgt tctcggtagt attaatgcgg atcatgttat ttctgtaccg        60
     cactttgcca aaccgggcga aacactaagt ggtaaacaat atcatattgc ttatggcgga       120
     aaaggtgcaa atcaagctgt ggcagcagca agattagcgg attttagcca aggtgcaaca       180
     gtgaattttg ttggttgtat tggtagtgat gatattgggc gagcgatgaa aaaagcgttt       240
     gcacaagatg gtattaatgt tgcgacaatt actgaaattc ctaatgaaat gactggaatt       300
     gcaatgattc aagtggctga tagcggagaa aacagtattg tcatttctgc cggtgcaaat       360
     gcatatttaa cgcctgagat tgtagataaa tttgcgacag aaattgagcg ggcggattat       420
     ttactcatgc aattggaaac accgttgaac gcaattttgg aagcagctaa attagctaag       480
     aaacatggtg cgacagtcgt attaaatcct gctcctgcga accaattacc tgatgaattg       540
     ctcagtttat tagatatgat tacgccgaat gaaacagaaa cggaaatttt aaccggtgtg       600
     aaggtaaccg acgagcaaag tgcggcgaaa gcagcgagtg ttttgcatca aaaaggtgtt       660
     gctactgtgt tgattacgtt aggttcaaaa ggtgtttatg tgagtcggaa atcttcgaca       720
     caagaactgg ggcagaataa ggttatagcc ggattcagag taaatgctgt agatacaact       780
     gcagccggtg atacgtttaa tggggcattt ttgaccgcac ttttagaaaa taaatctctt       840
     gacgaagcga ttcgttttgc acatgcggcg gcagcgatta gtgtgacgcg tcaaggggca       900
     caaccttcca ttccaactcg tcgagaaaca ttagactttt tggcacaaca ttaa             954
//

If you have problems or comments...

PBIL Back to PBIL home page