(data stored in ACNUC7421 zone)

EMBL: CP000947.PE94

CP000947.PE94        Location/Qualifiers
FT   CDS_pept        103319..104329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0094"
FT                   /product="Alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: hso:HS_0226
FT                   ribose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32623"
FT                   /db_xref="GOA:B0UV52"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV52"
FT                   /protein_id="ACA32623.1"
FT                   /translation="MATMKDIARIAQVSTSTVSHVINNSRFVSEEIRQKVMAVVEQLNY
FT                   TPSALARSLKVKETKTIGMLVTTSDNPFFAEVVASVERYCRQHHYHLILCNTNDDSICL
FT                   QENLQNLIRKQVDGLLLMCTDSAFETSPLNLTVPTVIMDWWPTELSADKIFEDSEQGGY
FT                   LATRTLIEHQHHDIAIITGNLKKPLARNRLKGYKQALQEYNIPIRDKWIIESHFNFEGG
FT                   IKGMEQLLQLKQRPSAVFACSDTIAVGAYQAVWRHGLSVPEDISIIGYDNIHLAQYLSP
FT                   PLSTVHQPKDEFAHLAVDTLLQRIKNPTESYRTLTLKPEIVLRQSICSCFLPKSA"
     atggctacaa tgaaagatat tgctcgaatt gcacaggtat caacgtccac tgtttctcat        60
     gtgattaata attcacgttt tgtcagtgaa gaaattcggc agaaagtcat ggcggtagtg       120
     gagcaactga attatacgcc ctcagcattg gctcgcagtt tgaaagtcaa agaaactaaa       180
     acaatcggaa tgctggtaac tacgagtgat aatccttttt ttgctgaggt tgtggcgagt       240
     gttgaacgtt attgtcgcca acatcattat catttgatct tatgcaatac caatgatgac       300
     agtatttgtc tgcaagaaaa tctgcaaaat ttgatacgca agcaggtcga tggattgctc       360
     ttgatgtgta cggatagtgc ctttgaaacc agtcctttaa atttaactgt tcctactgtc       420
     atcatggatt ggtggccgac agagctgagt gcggataaaa tttttgagga ttccgagcag       480
     ggcggatatt tggcgacacg gactcttatt gagcatcaac atcatgatat tgcgattatt       540
     acgggaaatc tgaaaaagcc tcttgctcgt aatcgtttga aaggctataa gcaagcgttg       600
     caagaataca acattcctat tcgtgataaa tggattattg aaagtcattt taactttgaa       660
     ggcggaatta agggaatgga acagttgtta caattgaaac agcgtccaag tgcggtgttt       720
     gcttgtagtg ataccattgc agtgggtgct tatcaagctg tttggcgtca tgggttatct       780
     gtgcctgaag atatttccat tattggttac gataatattc atttagcaca atatctttct       840
     cctccactaa gcaccgttca tcaacctaaa gatgaattcg cacacttggc agtagataca       900
     ttgttgcaac gaataaaaaa tcctaccgaa agttaccgca cgttgacgtt aaaacctgag       960
     atagtattgc gtcaatctat ttgttcctgt tttttgccta agtccgcata g               1011
//

If you have problems or comments...

PBIL Back to PBIL home page