(data stored in ACNUC7421 zone)

EMBL: CP000947.PE95

CP000947.PE95        Location/Qualifiers
FT   CDS_pept        complement(104358..104771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0095"
FT                   /product="SmpA/OmlA domain protein"
FT                   /note="PFAM: SmpA/OmlA domain protein; KEGG: hso:HS_0227
FT                   conserved small protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32634"
FT                   /db_xref="GOA:B0UV53"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV53"
FT                   /protein_id="ACA32634.1"
FT                   /translation="MRLKFIIPAMILGLSVTACSSVQKIVYRIDVPQGNYLESTAVEQV
FT                   KVGMNAQQVQYLLGTPMLIDPFSNQTWYYVFLQQKSYNAPEQHTFIVNFDRRGIVTDVN
FT                   LDKPLPDVEKEYINNTIIQGPEAKRTSWWKFWR"
     atgcgattaa aatttattat tcctgctatg attttaggat taagcgttac cgcttgttcc        60
     agtgttcaaa aaatcgttta tcgtattgat gttccacaag gaaactattt agaatctacc       120
     gctgtagaac aagtgaaagt gggcatgaat gcacaacaag ttcagtactt acttggtacg       180
     ccaatgctaa tagatccatt tagcaatcaa acttggtact acgtattttt acaacaaaaa       240
     tcttataatg cacctgagca acatactttt attgtgaatt ttgatcgacg cggtattgtc       300
     accgacgtta atttagataa accgctacct gatgttgaaa aagaatatat caataataca       360
     atcattcaag gtccggaagc aaaacgcaca agctggtgga aattttggag ataa             414
//

If you have problems or comments...

PBIL Back to PBIL home page