(data stored in ACNUC7421 zone)

EMBL: CP000947.PE96

CP000947.PE96        Location/Qualifiers
FT   CDS_pept        complement(104839..105852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0096"
FT                   /product="37kDa nucleoid-associated protein"
FT                   /note="PFAM: 37kDa nucleoid-associated protein; KEGG:
FT                   hso:HS_0228 possible nucleoid-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32645"
FT                   /db_xref="GOA:B0UV54"
FT                   /db_xref="InterPro:IPR007358"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV54"
FT                   /protein_id="ACA32645.1"
FT                   /translation="MSIIVNQIVLHQLVKTSQDENTVQLKTHLRDELLPITAETEQMML
FT                   QLHQEYQNKTKAYGVFQETSNFAQILNRTLENDIDFLAFSHQSAELLRQELGKYSFAND
FT                   GTLILCQYNFLATDYLFIALLDSRYSMLVDENLEIKQTHYLDITQFDIACRINLTELHL
FT                   DAKSTRYLTFIKGRVGRKIADFFMDFLGAEEGLNPQVQNQCLLQAVSDYCQQADLTKEQ
FT                   TQAVKKQVFDYCKGQINVGEEIVVTELSANIPTLNEQSFVDFAVSQNYGLEENIPPVRT
FT                   ALKSLTKFSGSGKGITLSFDAELLNSRIFWDEATDSLTITGLPPNLRDQLQRQTKE"
     atgagcatta tagtcaatca aattgttttg catcaattgg ttaaaacatc acaagatgaa        60
     aataccgttc aacttaaaac gcatttacgt gatgaattat taccaattac agcggaaaca       120
     gaacaaatga tgttgcaatt acatcaagag tatcaaaata aaacaaaagc ctatggagta       180
     ttccaagaaa cctcaaattt tgctcaaata ctcaaccgca cattggaaaa cgatattgat       240
     ttcttggcat ttagtcatca atcagccgaa ttattacgtc aagagttggg aaaatacagt       300
     tttgccaatg atggcacgtt aattttgtgt caatacaatt ttctcgcaac agattattta       360
     ttcatcgcat tattagatag tcgctatagt atgttggttg atgaaaatct ggaaataaaa       420
     caaacgcatt atcttgatat tactcaattt gatattgctt gccgaattaa tttaaccgaa       480
     ttgcatttag atgcaaaatc aactcgttat ctgactttta ttaaaggtcg agttggacgc       540
     aaaattgctg acttttttat ggatttttta ggtgcagaag agggattaaa tcctcaagtg       600
     caaaatcaat gtttattaca agcagttagt gactactgcc aacaggcgga tttgacaaaa       660
     gaacaaactc aagcggtcaa aaaacaagta ttcgattatt gtaaaggaca aataaatgta       720
     ggcgaagaaa tcgttgtcac ggaactttcc gccaatatac ccactctaaa tgaacagtct       780
     tttgttgatt tcgctgtcag ccaaaattat ggcttagaag aaaatattcc tcccgtacgt       840
     actgcattaa aatcgttgac taaattttcc ggctcaggaa aaggtatcac attaagtttt       900
     gatgccgagt tattaaacag tcgtatattt tgggatgaag caacggatag tttaaccatt       960
     acaggactac cgccgaattt acgcgatcaa ctacaacgcc aaacaaaaga ataa            1014
//

If you have problems or comments...

PBIL Back to PBIL home page