(data stored in ACNUC7421 zone)

EMBL: CP000947.PE97

CP000947.PE97        Location/Qualifiers
FT   CDS_pept        105970..106191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0097"
FT                   /product="protein of unknown function DUF1414"
FT                   /note="PFAM: protein of unknown function DUF1414; KEGG:
FT                   hso:HS_0229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32656"
FT                   /db_xref="InterPro:IPR009857"
FT                   /db_xref="InterPro:IPR023202"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV55"
FT                   /protein_id="ACA32656.1"
FT                   /translation="MAKISKFQDKQVEAILNDMIAVLEKHQAPVDLSLVVLGNMVTHLL
FT                   NSSVGSQQRIVLAKVFSDALMNSVKNSK"
     atggcaaaaa tttcaaaatt tcaagataaa caagttgagg caatattgaa tgatatgatc        60
     gctgtactgg aaaagcatca agctccggta gatctttctt tagtcgtatt gggcaatatg       120
     gtaacccatt tgttaaacag tagtgttggg tcgcaacaac gtattgtgtt ggcaaaagta       180
     ttttccgatg ctttaatgaa ttcagtaaaa aatagtaaat aa                          222
//

If you have problems or comments...

PBIL Back to PBIL home page