(data stored in ACNUC7421 zone)

EMBL: CP000947.PE98

CP000947.PE98        Location/Qualifiers
FT   CDS_pept        106193..107935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0098"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: hso:HS_0230 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32665"
FT                   /db_xref="GOA:B0UV56"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012159"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024588"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV56"
FT                   /protein_id="ACA32665.1"
FT                   /translation="MFGIKTSKQYRDELSRKITWGHWFAFFNILWAIVIGSRYAFIIDW
FT                   PHTLFGKIYFFISLLGHFSFIVFALYLLALFPLSFIIKNERTFRGISVILTTIGATLLL
FT                   VDTEVFSRFNLHLSTLVWNLLVNPDDGKLSYKWQIFFAPMPLILFVQMLFSRWAWYKLR
FT                   SLERQKWIKGVALVFVVSFIATHILYAWADAYIYRPITMQKSNFPLSYPMTARSFLEKH
FT                   GFLNKSEYEKTLNEQGRLDALKVNYPKQKLTFSDELPKTNIVLITISGLRHDAVRQDIM
FT                   PNLFAFSENSTDFTHHYSSGNSLNQGLTGLFYGLNANYADSLLSNKTTPVLIERLKQGK
FT                   VRYEIGLFGQNLSRSILLKKSIFANEKIRNDNNTSTRRFIEFVNTRQQQQKLFFAYLNY
FT                   SLNSNLTIEQYYQKLSEIDDEIGSAFKSIDFTHTIVIVTSEYGYSFDFSDKKRPTNYFA
FT                   REVIQVPMIIRWENLPIGKVNKLSSHTDLVPALMKHIFKVKNPISDFSQGQDLFDLDDN
FT                   RSWVLAGNYRWNVIITPDDSQYHIDRNGHYQKYNQHYQKISSTQPPLGLFLEVFSQNTA
FT                   FIEK"
     atgtttggaa ttaaaacaag caagcaatat cgtgatgaat tatctcgtaa gattacgtgg        60
     ggacattggt ttgctttttt taatattttg tgggcaattg ttattggtag tcgttatgcc       120
     tttattattg attggccgca tactttattc ggtaaaatat atttttttat tagtttattg       180
     gggcatttca gcttcattgt ttttgctctc tatttgctcg ctctctttcc tctcagtttt       240
     attataaaaa atgaacgcac ttttcgtggg ataagcgtta ttttaacaac gataggtgca       300
     accttactgt tggttgatac agaggtgttt tctcgtttta atttacatct ttcaaccctc       360
     gtttggaatt tgttggttaa tcctgatgat ggtaagttat cttataagtg gcaaatattt       420
     tttgcaccta tgccattgat tttatttgtt caaatgcttt tctcacgttg ggcatggtat       480
     aaattacgca gtttagagag acaaaaatgg attaaaggtg ttgctcttgt atttgttgtt       540
     agctttattg ctacacatat tctttatgct tgggcagatg cgtatattta tcgcccgatt       600
     accatgcaaa aatcgaattt ccctctatct tatccaatga cagcacgttc atttctcgaa       660
     aaacatggtt tcttaaataa gtctgaatat gaaaaaacct taaatgagca aggtcgtctt       720
     gatgcgttaa aagtgaatta tccaaagcag aaattaactt tttccgatga gttgccaaag       780
     acgaatattg tccttatcac cattagtgga ttacgtcatg atgcagttcg acaggatata       840
     atgcctaatt tatttgcatt ttctgagaat tcaactgact ttactcatca ttacagttca       900
     ggaaactctc ttaatcaagg tttgacagga ttgttttatg gattgaatgc taattatgcg       960
     gacagcttac ttagcaataa aacaacacct gtattaattg agcggctaaa acaaggaaaa      1020
     gtgcggtatg aaatcggtct atttggtcag aatttatctc gaagtatatt attgaagaaa      1080
     agtatttttg caaatgagaa aataagaaat gacaacaata cctctacgcg gcgttttatt      1140
     gagtttgtta atactcgaca acaacagcaa aaattatttt ttgcctatct aaattattca      1200
     ctgaacagca atttgactat tgaacaatat tatcaaaagt tatctgaaat tgatgatgag      1260
     attggttcgg catttaagtc gatagatttt actcatacca ttgtgatagt gacttccgaa      1320
     tatggttata gttttgattt ttctgataaa aaaagaccaa ctaattattt tgcaagagaa      1380
     gtaattcaag ttccaatgat tataagatgg gaaaatttac ctatcggtaa agtgaataaa      1440
     ttgagtagtc ataccgattt ggtaccagcc ttaatgaaac atatttttaa agtaaaaaat      1500
     ccaattagcg atttttctca ggggcaggat ttatttgatt tggatgataa tcgtagttgg      1560
     gttcttgctg gtaattaccg ttggaatgta atcattacac cggatgattc gcaatatcat      1620
     attgatagga atgggcatta tcaaaaatac aatcaacatt atcaaaaaat ttcgtcaaca      1680
     caacctccgt taggattatt cttagaagta ttttcacaga atacggcttt catcgaaaaa      1740
     tag                                                                    1743
//

If you have problems or comments...

PBIL Back to PBIL home page