(data stored in ACNUC7421 zone)

EMBL: CP000947.PE99

CP000947.PE99        Location/Qualifiers
FT   CDS_pept        complement(108151..108867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0099"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="PFAM: sugar fermentation stimulation protein; KEGG:
FT                   hso:HS_0231 sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32676"
FT                   /db_xref="GOA:B0UV57"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV57"
FT                   /protein_id="ACA32676.1"
FT                   /translation="MQLPNLQSATLLRRYKRFLADVELNNGEILTLHCANTGAMTGCGE
FT                   KGDTVWFSTSDSKTRKYPHSWELTQLKNGQTVCINTHRSNQLTLEALQNKIITELAEYD
FT                   EILPEVKYGVENSRIDFLLKGKNLPDCYVEVKSVTFVKNHLGLFPDAVTTRGQKHLREL
FT                   IAMKKRGHRAVVFFAGLHDGFNRFTVAKSIDPDYAELLQQAVKEGVEVYSYAVKFDFSH
FT                   QKPTALYLTNLVSYLE"
     atgcaattac cgaatttaca atcagcaaca ttacttcgcc gttataaacg ctttttggca        60
     gatgtagaat taaacaacgg tgaaatttta acgcttcatt gtgccaatac cggtgcgatg       120
     acaggatgtg gtgaaaaagg cgatactgtt tggttttcta cttctgacag caaaacaaga       180
     aaatacccgc actcttggga attaactcaa cttaaaaatg gtcaaacggt atgtatcaat       240
     actcaccgtt ccaatcaatt aactttagag gctttgcaaa ataaaatcat cacagaatta       300
     gctgaatatg atgagatttt gcctgaagta aaatatggtg tagaaaatag tcgcattgat       360
     tttttactca aaggtaaaaa cttaccggat tgttatgtcg aagtaaaatc cgttacgttt       420
     gtcaaaaatc atctcggttt gttccctgat gccgtcacaa caagaggaca aaaacacttg       480
     cgtgagctta tagcaatgaa aaaacggggt catagagcgg tcgttttttt cgcaggtctt       540
     cacgacggtt ttaatcgctt caccgttgca aaatctattg atcctgatta tgccgaatta       600
     ctgcagcaag cagttaaaga aggtgttgaa gtttatagct atgccgtgaa atttgatttt       660
     tctcatcaaa aaccaaccgc actttatcta acaaatttag tgagttacct agaataa          717
//

If you have problems or comments...

PBIL Back to PBIL home page