(data stored in ACNUC7421 zone)

EMBL: CP000948.ACCA

CP000948.ACCA        Location/Qualifiers
FT   CDS_pept        182725..183684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="ECDH10B_0165"
FT                   /product="acetyl-CoA carboxylase, carboxytransferase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01363"
FT                   /db_xref="GOA:B1XD54"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XD54"
FT                   /protein_id="ACB01363.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLRE
FT                   KSVELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGG
FT                   IARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEA
FT                   MAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA"
     atgagtctga atttccttga ttttgaacag ccgattgcag agctggaagc gaaaatcgat        60
     tctctgactg cggttagccg tcaggatgag aaactggata ttaacatcga tgaagaagtg       120
     catcgtctgc gtgaaaaaag cgtagaactg acacgtaaaa tcttcgccga tctcggtgca       180
     tggcagattg cgcaactggc acgccatcca cagcgtcctt ataccctgga ttacgttcgc       240
     ctggcatttg atgaatttga cgaactggct ggcgaccgcg cgtatgcaga cgataaagct       300
     atcgtcggtg gtatcgcccg tctcgatggt cgtccggtga tgatcattgg tcatcaaaaa       360
     ggtcgtgaaa ccaaagaaaa aattcgccgt aactttggta tgccagcgcc agaaggttac       420
     cgcaaagcac tgcgtctgat gcaaatggct gaacgcttta agatgcctat catcaccttt       480
     atcgacaccc cgggggctta tcctggcgtg ggcgcagaag agcgtggtca gtctgaagcc       540
     attgcacgca acctgcgtga aatgtctcgc ctcggcgtac cggtagtttg tacggttatc       600
     ggtgaaggtg gttctggcgg tgcgctggcg attggcgtgg gcgataaagt gaatatgctg       660
     caatacagca cctattccgt tatctcgccg gaaggttgtg cgtccattct gtggaagagc       720
     gccgacaaag cgccgctggc ggctgaagcg atgggtatca ttgctccgcg tctgaaagaa       780
     ctgaaactga tcgactccat catcccggaa ccactgggtg gtgctcaccg taacccggaa       840
     gcgatggcgg catcgttgaa agcgcaactg ctggcggatc tggccgatct cgacgtgtta       900
     agcactgaag atttaaaaaa tcgtcgttat cagcgcctga tgagctacgg ttacgcgtaa       960
//

If you have problems or comments...

PBIL Back to PBIL home page