(data stored in ACNUC7421 zone)

EMBL: CP000948.ADK

CP000948.ADK         Location/Qualifiers
FT   CDS_pept        435730..436374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="ECDH10B_0430"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01601"
FT                   /db_xref="GOA:B1XFR1"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XFR1"
FT                   /protein_id="ACB01601.1"
FT                   /translation="MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSEL
FT                   GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVD
FT                   YVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEET
FT                   VRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG"
     atgcgtatca ttctgcttgg cgctccgggc gcggggaaag ggactcaggc tcagttcatc        60
     atggagaaat atggtattcc gcaaatctcc actggcgata tgctgcgtgc tgcggtcaaa       120
     tctggctccg agctgggtaa acaagcaaaa gacattatgg atgctggcaa actggtcacc       180
     gacgaactgg tgatcgcgct ggttaaagag cgcattgctc aggaagactg ccgtaatggt       240
     ttcctgttgg acggcttccc gcgtaccatt ccgcaggcag acgcgatgaa agaagcgggc       300
     atcaatgttg attacgttct ggaattcgac gtaccggacg aactgatcgt tgaccgtatc       360
     gtcggtcgcc gcgttcatgc gccgtctggt cgtgtttatc acgttaaatt caatccgccg       420
     aaagtagaag gcaaagacga cgttaccggt gaagaactga ctacccgtaa agatgatcag       480
     gaagagaccg tacgtaaacg tctggttgaa taccatcaga tgacagcacc gctgatcggc       540
     tactactcca aagaagcaga agcgggtaat accaaatacg cgaaagttga cggcaccaag       600
     ccggttgctg aagttcgcgc tgatctggaa aaaatcctcg gctaa                       645
//

If you have problems or comments...

PBIL Back to PBIL home page