(data stored in ACNUC7421 zone)

EMBL: CP000948.AFUB

CP000948.AFUB        Location/Qualifiers
FT   CDS_pept        complement(252142..252504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuB"
FT                   /locus_tag="ECDH10B_0249"
FT                   /product="CP4-6 prophage; predicted ferric trasnporter
FT                   subunit; membrane component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01429"
FT                   /protein_id="ACB01429.1"
FT                   /translation="MESLPGQIDKSLDEASLSLRAGSLRTITHILLPLLRPAILSALIY
FT                   SFVRAITTVSAIVFLVTPDTRVATAYILNRVEDGEYGVAIAYGSILIVVMLAIIFIFDW
FT                   LIGESRTSRSKAKNQA"
     ttggagtcat taccgggcca aatcgataaa tcgctcgatg aagcctcact cagcctgcgc        60
     gccggttccc tgcgtaccat tacgcacatc ctgctgccgc tgctgcgccc ggcgatcctc       120
     tcggcgctga tttacagctt tgtgcgcgcc attaccaccg tcagcgccat tgtgttcctc       180
     gtcacgccgg atacccgcgt agcgacggct tacatcctca accgcgtgga agatggcgaa       240
     tacggtgtag cgattgccta cggttccatt ctgatcgtgg tgatgctggc gattattttc       300
     atctttgact ggctgatcgg tgaatcacgt acctcccgtt caaaagccaa aaaccaggcg       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page