(data stored in ACNUC7421 zone)

EMBL: CP000948.AFUC

CP000948.AFUC        Location/Qualifiers
FT   CDS_pept        complement(251084..252130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuC"
FT                   /locus_tag="ECDH10B_0248"
FT                   /product="CP4-6 prophage; predicted ferric transporter
FT                   subunit; ATP-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01428"
FT                   /protein_id="ACB01428.1"
FT                   /translation="MTQKNFVELRNVTKRFGSNTVIDNINLTIPQGQMVTLLGPSGCGK
FT                   TTILRLVAGLEKPSEGQIFIDGEDVTHRSIQQRDICMVFQSYALFPHMSLGENVGYGLK
FT                   MLGVPRAELKARVKEALAMVDLEGFEDRFVDQISGGQQQRVALARALILKPKVLLFDEP
FT                   LSNLDANLRRSMRDKIRELQKQFDITSLYVTHDQSEAFAVSDTVLVMNKGHIMQIGSPQ
FT                   DLYRQPASRFMASFMGDANLFPATFSDGYVDIYGYHLPRPLHFGTQGEGMVGVRPEAIT
FT                   LSDRGEESQRCVIRHVAYMGPQYEVTVEWHGQEILLQVNATRLQPDVGEQYYLEIHPYG
FT                   MFVLADAA"
     atgactcaga aaaatttcgt tgaactgcgc aacgtcacta aacgatttgg cagtaatacg        60
     gtaatcgaca atatcaacct caccatcccg caggggcaaa tggtgacgct gctcggcccg       120
     tccggctgcg gcaaaaccac tattttgcgc ctggttgccg ggctggaaaa accgagcgaa       180
     gggcaaattt tcattgatgg cgaagacgtc acccatcgct ctattcagca gcgcgatatc       240
     tgtatggtgt ttcagtccta tgccctgttc ccgcatatgt cgctgggaga gaatgtcggt       300
     tatggcctga aaatgctcgg cgtaccgcgc gcagagctga aagcccgcgt caaagaggcg       360
     ttggcgatgg tggatctgga aggattcgaa gaccgctttg tcgatcagat ctccggcggg       420
     cagcagcagc gcgtggcgct ggcccgcgcg ctgatcctca agccgaaagt gctgctgttt       480
     gatgagccgt tgagtaacct cgacgccaac ctgcgtcgca gcatgcgcga caagatccgc       540
     gagttgcaaa agcagtttga tatcacctcg ctgtacgtca cccacgatca gagcgaagcc       600
     tttgcggttt ctgatactgt gctggtgatg aacaagggac acatcatgca gatcggctca       660
     ccgcaggatc tttaccgcca gcccgcctcc cgctttatgg cgagctttat gggcgatgcc       720
     aacctgttcc cggcaacctt cagcgacgga tacgttgata tctacggcta tcatctgccg       780
     cgcccgctgc actttggtac acagggtgaa gggatggtcg gtgtgcgccc ggaagcgatc       840
     acgctcagcg atcgcggcga agagagccag cgctgcgtga tccgccatgt cgcctatatg       900
     gggccgcagt atgaagtgac ggtggaatgg cacgggcagg agatattatt gcaggtcaac       960
     gctacgcgtc tgcaaccgga cgtcggcgag cagtattatc ttgaaatcca tccgtacggc      1020
     atgtttgttc tggcggatgc ggcataa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page