(data stored in ACNUC7421 zone)

EMBL: CP000948.AMPE

CP000948.AMPE        Location/Qualifiers
FT   CDS_pept        93385..94239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="ECDH10B_0091"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01290"
FT                   /protein_id="ACB01290.1"
FT                   /translation="MTLFTTLLVLIFERLFKLGEHWQLDHRLEAFFRRVKHFSLGRTLG
FT                   MTIIAMGVTFLLLRALQGVLFNVPTLLVWLLIGLLCIGAGKVRLHYHAYLTAASRNDSH
FT                   ARATMAGELTMIHGVPAGCDEREYLRELQNALLWINFRFYLAPLFWLIVGGTWGPVTLM
FT                   GYAFLRAWQYWLARYQTPHHRLQSGIDAVLHVLDWVPVRLAGVVYALIGHGEKALPAWF
FT                   ASLGDFHTSQYQVLTRLAQFSLAREPHVDKVETPKAAVSMAKKTSFVVVVVIALLTIYG
FT                   ALV"
     atgacgctat ttacaacctt actggtgtta attttcgagc gcctgtttaa gttgggcgag        60
     cactggcagc ttgatcatcg tcttgaagcg ttctttcggc gggtgaaaca tttttctctc       120
     gggcgcacgt taggcatgac cattattgcg atgggcgtga cttttttact gttacgcgca       180
     ttgcagggag tattgttcaa cgttcccacg ctactggtgt ggctgctgat tggtttgctg       240
     tgtattggcg caggtaaagt tcgtcttcat tatcatgctt atctgacagc tgcttcacgt       300
     aatgatagcc atgcccgtgc cacgatggct ggcgaactca ccatgattca cggcgtcccg       360
     gcaggctgcg acgaacgtga gtatttgcgt gagctgcaaa atgcattgct gtggattaac       420
     tttcgttttt atcttgcacc gctgttctgg ctgattgtgg ggggaacctg gggacccgtt       480
     acgctgatgg ggtatgcgtt tttgcgtgca tggcaatact ggctggcgcg atatcagacg       540
     ccgcatcatc gtttacagtc cggcattgat gccgtgcttc atgtactgga ttgggtgccg       600
     gttcgtcttg cgggtgtggt atatgccttg atcggtcatg gtgagaaagc gttaccggcc       660
     tggtttgctt cgctgggtga tttccatact tcgcagtatc aggtgttaac gcgtctggcg       720
     cagttctctc tggcgcgtga accgcatgtc gataaggtgg agacgccgaa ggcagcggtt       780
     tcaatggcga agaaaacctc gttcgtggtc gtggtggtga ttgcactact gacgatttac       840
     ggggcgttgg tgtaa                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page