(data stored in ACNUC7421 zone)

EMBL: CP000948.AROL

CP000948.AROL        Location/Qualifiers
FT   CDS_pept        344960..345484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroL"
FT                   /locus_tag="ECDH10B_0345"
FT                   /product="shikimate kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01517"
FT                   /db_xref="GOA:B1XEX7"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027544"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XEX7"
FT                   /protein_id="ACB01517.1"
FT                   /translation="MTQPLFLIGPRGCGKTTVGMALADSLNRRFVDTDQWLQSQLNMTV
FT                   AEIVEREEWAGFRARETAALEAVTAPSTVIATGGGIILTEFNRHFMQNNGIVVYLCAPV
FT                   SVLVNRLQAAPEEDLRPTLTGKPLSEEVQEVLEERDALYREVAHIIIDATNEPSQVISE
FT                   IRSALAQTINC"
     atgacacaac ctctttttct gatcgggcct cggggctgtg gtaaaacaac ggtcggaatg        60
     gcccttgccg attcgcttaa ccgtcggttt gtcgataccg atcagtggtt gcaatcacag       120
     ctcaatatga cggtcgcgga gatcgtcgaa agggaagagt gggcgggatt tcgcgccaga       180
     gaaacggcgg cgctggaagc ggtaactgcg ccatccaccg ttatcgctac aggcggcggc       240
     attattctga cggaatttaa tcgtcacttc atgcaaaata acgggatcgt ggtttatttg       300
     tgtgcgccag tatcagtcct ggttaaccga ctgcaagctg caccggaaga agatttacgg       360
     ccaaccttaa cgggaaaacc gctgagcgaa gaagttcagg aagtgctgga agaacgcgat       420
     gcgctatatc gcgaagttgc gcatattatc atcgacgcaa caaacgaacc cagccaggtg       480
     atttctgaaa ttcgcagcgc cctggcacag acgatcaatt gttga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page