(data stored in ACNUC7421 zone)

EMBL: CP000948.BRNQ

CP000948.BRNQ        Location/Qualifiers
FT   CDS_pept        358146..359465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="ECDH10B_0357"
FT                   /product="predicted branched chain amino acid transporter
FT                   (LIV-II)"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01529"
FT                   /protein_id="ACB01529.1"
FT                   /translation="MTHQLRSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAA
FT                   FGFLITAVGLPVLTVVALAKVGGGVDSLSTPIGKVAGVLLATVCYLAVGPLFATPRTAT
FT                   VSFEVGIAPLTGDSALPLFIYSLVYFAIVILVSLYPGKLLDTVGNFLAPLKIIALVILS
FT                   VAAIVWPAGSISTATEAYQNAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVTEAR
FT                   LLTRYTVWAGLMAGVGLTLLYLALFRLGSDSASLVDQSANGAAILHAYVQHTFGGGGSF
FT                   LLAALIFIACLVTAVGLTCACAEFFAQYVPLSYRTLVFILGGFSMVVSNLGLSQLIQIS
FT                   VPVLTAIYPPCIALVVLSFTRSWWHNSSRVIAPPMFISLLFGILDGIKASAFSDILPSW
FT                   AQRLPLAEQGLAWLMPTVVMVVLAIIWDRAAGRQVTSSAH"
     atgacccatc aattaagatc gcgcgatatc atcgctctgg gctttatgac atttgcgttg        60
     ttcgtcggcg caggtaacat tattttccct ccaatggtcg gcttacaggc aggcgaacac       120
     gtctggactg cggcattcgg cttcctcatt actgccgttg gcctgccggt attaacggta       180
     gtggcgctgg caaaagttgg cggcggtgtt gacagcctca gcacgccaat cggtaaagtc       240
     gctggcgtac tgctggcaac ggtttgttac ctggcggtgg ggccgctttt cgctacgccg       300
     cgtacagcta ccgtttcctt tgaagtgggg attgcgccgc tgacgggtga ttccgcgctg       360
     ccgctgttta tctacagcct ggtctatttc gctatcgtta ttctggtttc gctctatccg       420
     ggcaagctgc tggataccgt gggcaacttc cttgcgccgc tgaaaattat cgcgctggtc       480
     atcctgtctg ttgccgctat tgtctggccg gcgggttcta tcagcacggc gactgaggct       540
     tatcaaaacg ctgcgttttc taacggcttc gttaacggct atctgaccat ggatacgctg       600
     ggcgcaatgg tgtttggtat cgttattgtt aacgcggcgc gttctcgtgg cgttaccgaa       660
     gcgcgtctgc tgacccgtta taccgtctgg gctggcctga tggcgggtgt tggtctgact       720
     ctgctgtacc tggcgctgtt ccgtctgggg tcagacagcg cgtcgctggt cgatcagtct       780
     gcaaacggcg ctgctattct gcatgcttac gttcagcaca cctttggcgg cggcggtagc       840
     ttcctgctgg cggcgttaat cttcatcgcc tgcctggtaa cggcagttgg cctgacctgt       900
     gcttgtgcag aattctttgc ccagtacgta ccgctctctt atcgtacgct ggtgtttatc       960
     ctcggcggct tctcgatggt ggtttctaac ctcggcttaa gccagctgat ccagatctcc      1020
     gtaccggtgc tgaccgctat ttatccgccg tgtatcgcac tggttgtatt aagttttaca      1080
     cgctcatggt ggcataattc gtcccgcgtg attgctccgc cgatgtttat cagcctgctt      1140
     tttggtattc tcgacgggat caaagcatct gcattcagcg atatcttacc gtcctgggcg      1200
     cagcgtttac cgctggccga acaaggtctg gcgtggttaa tgccaacagt ggtgatggtg      1260
     gttctggcca ttatctggga tcgcgcggca ggtcgtcagg tgacctccag cgctcactaa      1320
//

If you have problems or comments...

PBIL Back to PBIL home page