(data stored in ACNUC7421 zone)

EMBL: CP000948.CAIA

CP000948.CAIA        Location/Qualifiers
FT   CDS_pept        complement(39244..40386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiA"
FT                   /locus_tag="ECDH10B_0040"
FT                   /product="crotonobetaine reductase subunit II, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01244"
FT                   /db_xref="GOA:B1XBG4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023450"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XBG4"
FT                   /protein_id="ACB01244.1"
FT                   /translation="MDFNLNDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVKA
FT                   LADMGIDSLLIPEEHGGLDAGFVTLAAVWMELGRLGAPTYVLYQLPGGFNTFLREGTQE
FT                   QIDKIMAFRGTGKQMWNSAITEPGAGSDVGSLKTTYTRRNGKIYLNGSKCFITSSAYTP
FT                   YIVVMARDGASPDKPVYTEWFVDMSKPGIKVTKLEKLGLRMDSCCEITFDDVELDEKDM
FT                   FGREGNGFNRVKEEFDHERFLVALTNYGTAMCAFEDAARYANQRVQFGEAIGRFQLIQE
FT                   KFAHMAIKLNSMKNMLYEAAWKADNGTITSGDAAMCKYFCANAAFEVVDSAMQVLGGVG
FT                   IAGNHRISRFWRDLRVDRVSGGSDEMQILTLGRAVLKQYR"
     atggatttta atttaaatga tgagcaggaa ctgtttgtcg ccggtatccg cgaactgatg        60
     gccagcgaaa actgggaggc ctattttgcc gagtgcgacc gtgacagcgt ctacccggaa       120
     cgttttgtca aagcactggc ggatatgggt atcgacagtc tgctgatccc tgaagagcac       180
     ggtggtctgg acgcggggtt tgttactctc gccgccgtgt ggatggagct gggacgtctg       240
     ggggcaccaa cctatgtgct gtaccagttg ccgggcgggt tcaacacctt cctgcgcgaa       300
     ggcacacaag agcagatcga caaaattatg gctttccgcg gcaccggtaa gcagatgtgg       360
     aactcagcga ttaccgaacc gggcgcgggc tccgacgtgg gtagcctgaa aacgacttat       420
     acccgtagaa atggtaagat ttatcttaat ggtagtaagt gttttattac cagcagcgcc       480
     tacaccccgt acatcgtggt gatggcgcgc gacggggctt ctccggacaa acctgtctac       540
     accgaatggt ttgttgatat gagcaaaccg ggcatcaaag tgaccaaact tgaaaagctc       600
     ggtctgcgta tggatagctg ctgtgaaatc acctttgacg acgtggaact ggacgagaaa       660
     gacatgttcg gtcgggaagg taacggcttt aaccgcgtca aagaagagtt cgaccatgaa       720
     cgtttcctgg tagccctcac caactacggt acggcgatgt gcgcctttga agatgcggcg       780
     cgctacgcca atcagcgcgt gcagtttggc gaggctattg gtcgtttcca gttgattcag       840
     gaaaaattcg cccacatggc gatcaaatta aactccatga aaaacatgct gtatgaagca       900
     gcgtggaaag cagacaacgg caccatcacc tctggcgatg cagcgatgtg caaatacttc       960
     tgcgccaatg cggcatttga agttgtggat agcgcaatgc aggtgctggg cggtgtcggg      1020
     attgcgggca accaccgcat cagccgcttc tggcgtgatc tgcgtgtaga ccgcgtctcc      1080
     gggggatctg acgaaatgca gatcctgacg ctgggtcgtg cggtgctgaa gcaataccgc      1140
     taa                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page