(data stored in ACNUC7421 zone)

EMBL: CP000948.CARA

CP000948.CARA        Location/Qualifiers
FT   CDS_pept        29651..30799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="ECDH10B_0033"
FT                   /product="carbamoyl phosphate synthetase small subunit,
FT                   glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01237"
FT                   /protein_id="ACB01237.1"
FT                   /translation="MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTD
FT                   PSYSRQIVTLTYPHIGNVGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKR
FT                   HNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVT
FT                   TAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQ
FT                   TSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGA
FT                   KTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGI
FT                   HRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRKTAK"
     ttgattaagt cagcgctatt ggttctggaa gacggaaccc agtttcacgg tcgggccata        60
     ggggcaacag gttcggcggt tggggaagtc gttttcaata cttcaatgac cggttatcaa       120
     gaaatcctca ctgatccttc ctattctcgt caaatcgtta ctcttactta tccccatatt       180
     ggcaatgtcg gcaccaatga cgccgatgaa gaatcttctc aggtacatgc acaaggtctg       240
     gtgattcgcg acctgccgct gattgccagc aacttccgta ataccgaaga cctctcttct       300
     tacctgaaac gccataacat cgtggcgatt gccgatatcg atacccgtaa gctgacgcgt       360
     ttactgcgcg agaaaggcgc acagaatggc tgcattatcg cgggcgataa cccggatgcg       420
     gcgctggcgt tagaaaaagc ccgcgcgttc ccaggtctga atggcatgga tctggcaaaa       480
     gaagtgacca ccgcagaagc ctatagctgg acacaaggga gctggacgtt gaccggtggc       540
     ctgccagaag cgaaaaaaga agacgagctg ccgttccacg tcgtggctta tgattttggt       600
     gccaagcgca acatcctgcg gatgctggtg gatagaggct gtcgcctgac catcgttccg       660
     gcgcaaactt ctgcggaaga tgtgctgaaa atgaatccag acggcatctt cctctccaac       720
     ggtcctggcg acccggcccc gtgcgattac gccattaccg ccatccagaa attcctcgaa       780
     accgatattc cggtattcgg catctgtctc ggtcatcagc tgctggcgct ggcgagcggt       840
     gcgaagactg tcaaaatgaa atttggtcac cacggcggca accatccggt taaagatgtg       900
     gagaaaaacg tggtaatgat caccgcccag aaccacggtt ttgcggtgga cgaagcaaca       960
     ttacctgcaa acctgcgtgt cacgcataaa tccctgttcg acggtacgtt acagggcatt      1020
     catcgcaccg ataaaccggc attcagcttc caggggcacc ctgaagccag ccctggtcca      1080
     cacgacgccg cgccgttgtt cgaccacttt atcgagttaa ttgagcagta ccgtaaaacc      1140
     gctaagtaa                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page