(data stored in ACNUC7421 zone)

EMBL: CP000948.CARB

CP000948.CARB        Location/Qualifiers
FT   CDS_pept        30817..34038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="ECDH10B_0034"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01238"
FT                   /protein_id="ACB01238.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLEEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEALAVAADVG
FT                   FPCIIRPSFTMGGSGGGIAYNREEFEEICARGLDLSPTKELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKDAGADRIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEKVAEVGITGLNADFLRQLKRKGFADARLAKLAGVREAEIRKLR
FT                   DQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEECEANPSTDREKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKP
FT                   KGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVERLKLKQPANAT
FT                   VTAIEMAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLD
FT                   HFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQ
FT                   VQKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAG
FT                   KSLAEQGVTKEVIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAK
FT                   AQLGSNSTMKKHGRALLSVREGDKERVVDLAAKLLKQGFELDATHGTAIVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIINTTSGRRAIEDSRVIRRSALQYKVHYDTTLNGGF
FT                   ATAMALNADATEKVISVQEMHAQIK"
     atgccaaaac gtacagatat aaaaagtatc ctgattctgg gtgcgggccc gattgttatc        60
     ggtcaggcgt gtgagtttga ctactctggc gcgcaagcgt gtaaagccct gcgtgaagag       120
     ggttaccgcg tcattctggt gaactccaac ccggcgacca tcatgaccga cccggaaatg       180
     gctgatgcaa cctacatcga gccgattcac tgggaagttg tacgcaagat tattgaaaaa       240
     gagcgcccgg acgcggtgct gccaacgatg ggcggtcaga cggcgctgaa ctgcgcgctg       300
     gagctggaac gtcagggcgt gttggaagag ttcggtgtca ccatgattgg tgccactgcc       360
     gatgcgattg ataaagcaga agaccgccgt cgtttcgacg tagcgatgaa gaaaattggt       420
     ctggaaaccg cgcgttccgg tatcgcacac acgatggaag aagcgctggc ggttgccgct       480
     gacgtgggct tcccgtgcat tattcgccca tcctttacca tgggcggtag cggcggcggt       540
     atcgcttata accgtgaaga gtttgaagaa atttgcgccc gcggtctgga tctctctccg       600
     accaaagagt tgctgattga tgagtcgctg atcggctgga aagagtacga gatggaagtg       660
     gtgcgtgata aaaacgacaa ctgcatcatc gtctgctcta tcgaaaactt cgatgcgatg       720
     ggcatccaca ccggtgactc catcactgtc gcgccagccc aaacgctgac cgacaaagaa       780
     tatcaaatca tgcgtaacgc ctcgatggcg gtgctgcgtg aaatcggcgt tgaaaccggt       840
     ggttccaacg ttcagtttgc ggtgaacccg aaaaacggtc gtctgattgt tatcgaaatg       900
     aacccacgcg tgtcccgttc ttcggcgctg gcgtcgaaag cgaccggttt cccgattgct       960
     aaagtggcgg cgaaactggc ggtgggttac accctcgacg aactgatgaa cgacatcact      1020
     ggcggacgta ctccggcctc cttcgagccg tccatcgact atgtggttac taaaattcct      1080
     cgcttcaact tcgaaaaatt cgccggtgct aacgaccgtc tgaccactca gatgaaatcg      1140
     gttggcgaag tgatggcgat tggtcgcacg cagcaggaat ccctgcaaaa agcgctgcgc      1200
     ggcctggaag tcggtgcgac tggattcgac ccgaaagtga gcctggatga cccggaagcg      1260
     ttaaccaaaa tccgtcgcga actgaaagac gcaggcgcag atcgtatctg gtacatcgcc      1320
     gatgcgttcc gtgcgggcct gtctgtggac ggcgtcttca acctgaccaa cattgaccgc      1380
     tggttcctgg tacagattga agagctggtg cgtctggaag agaaagtggc ggaagtgggc      1440
     atcactggcc tgaacgctga cttcctgcgc cagctgaaac gcaaaggctt tgccgatgcg      1500
     cgcttggcaa aactggcggg cgtacgcgaa gcggaaatcc gtaagctgcg tgaccagtat      1560
     gacctgcacc cggtttataa gcgcgtggat acctgtgcgg cagagttcgc caccgacacc      1620
     gcttacatgt actccactta tgaagaagag tgcgaagcga atccgtctac cgaccgtgaa      1680
     aaaatcatgg tgcttggcgg cggcccgaac cgtatcggtc agggtatcga attcgactac      1740
     tgttgcgtac acgcctcgct ggcgctgcgc gaagacggtt acgaaaccat tatggttaac      1800
     tgtaacccgg aaaccgtctc caccgactac gacacttccg accgcctcta cttcgagccg      1860
     gtaactctgg aagatgtgct ggaaatcgtg cgtatcgaga agccgaaagg cgttatcgtc      1920
     cagtacggcg gtcagacccc gctgaaactg gcgcgcgcgc tggaagctgc tggcgtaccg      1980
     gttatcggca ccagcccgga tgctatcgac cgtgcagaag accgtgaacg cttccagcat      2040
     gcggttgagc gtctgaaact gaaacaaccg gcgaacgcca ccgttaccgc tattgaaatg      2100
     gcggtagaga aggcgaaaga gattggctac ccgctggtgg tacgtccgtc ttacgttctc      2160
     ggcggtcggg cgatggaaat cgtctatgac gaagctgacc tgcgtcgcta cttccagacg      2220
     gcggtcagcg tgtctaacga tgcgccagtg ttgctggacc acttcctcga tgacgcggta      2280
     gaagttgacg tggatgccat ctgcgacggc gaaatggtgc tgattggcgg catcatggag      2340
     catattgagc aggcgggcgt gcactccggt gactccgcat gttctctgcc agcctacacc      2400
     ttaagtcagg aaattcagga tgtgatgcgc cagcaggtgc agaaactggc cttcgaattg      2460
     caggtgcgcg gcctgatgaa cgtgcagttt gcggtgaaaa acaacgaagt ctacctgatt      2520
     gaagttaacc cgcgtgcggc gcgtaccgtt ccgttcgtct ccaaagccac cggcgtaccg      2580
     ctggcaaaag tggcggcgcg cgtgatggct ggcaaatcgc tggctgagca gggcgtaacc      2640
     aaagaagtta tcccgccgta ctactcggtg aaagaagtgg tgctgccgtt caataaattc      2700
     ccgggcgttg acccgctgtt agggccagaa atgcgctcta ccggggaagt catgggcgtg      2760
     ggccgcacct tcgctgaagc gtttgccaaa gcgcagctgg gcagcaactc caccatgaag      2820
     aaacacggtc gtgcgctgct ttccgtgcgc gaaggcgata aagaacgcgt ggtggacctg      2880
     gcggcaaaac tgctgaaaca gggcttcgag ctggatgcga cccacggcac ggcgattgtg      2940
     ctgggcgaag caggtatcaa cccgcgtctg gtaaacaagg tgcatgaagg ccgtccgcac      3000
     attcaggacc gtatcaagaa tggcgaatat acctacatca tcaacaccac ctcaggccgt      3060
     cgtgcgattg aagactcccg cgtgattcgt cgcagtgcgc tgcaatataa agtgcattac      3120
     gacaccaccc tgaacggcgg ctttgccacc gcgatggcgc tgaatgccga tgcgactgaa      3180
     aaagtaattt cggtgcagga aatgcacgca cagatcaaat aa                         3222
//

If you have problems or comments...

PBIL Back to PBIL home page