(data stored in ACNUC7421 zone)

EMBL: CP000948.CITD

CP000948.CITD        Location/Qualifiers
FT   CDS_pept        complement(589042..589338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citD"
FT                   /locus_tag="ECDH10B_0577"
FT                   /product="citrate lyase, acyl carrier (gamma) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01740"
FT                   /protein_id="ACB01740.1"
FT                   /translation="MKINQPAVAGTLESGDVMIRIAPLDTQDIDLQINSSVEKQFGDAI
FT                   RTTILDVLARYNVRGVQLNVDDKGALDCILRARLEALLARASGIPALPWEDCQ"
     atgaaaataa accagcccgc cgttgcaggc acccttgagt ctggggatgt gatgatacgc        60
     atcgccccac tcgatacgca ggatatcgac ctgcaaatca atagcagcgt tgagaaacag       120
     tttggcgatg caattcgcac caccattctg gacgttctcg cccgctacaa cgtgcgcggc       180
     gtacagctga atgtcgatga caaaggcgca ctggactgca ttttacgtgc acgactggaa       240
     gccctgctgg cacgcgccag cggtatcccg gctctgccat gggaggattg ccaatga          297
//

If you have problems or comments...

PBIL Back to PBIL home page