(data stored in ACNUC7421 zone)

EMBL: CP000948.CLPX

CP000948.CLPX        Location/Qualifiers
FT   CDS_pept        395981..397255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="ECDH10B_0394"
FT                   /product="ATPase and specificity subunit of ClpX-ClpP
FT                   ATP-dependent serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01566"
FT                   /db_xref="GOA:B1XFM6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XFM6"
FT                   /protein_id="ACB01566.1"
FT                   /translation="MTDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCN
FT                   DIIREEIKEVAPHRERSALPTPHEIRNHLDDYVIGQEQAKKVLAVAVYNHYKRLRNGDT
FT                   SNGVELGKSNILLIGPTGSGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQ
FT                   KLLQKCDYDVQKAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVAAV
FT                   PPQGGRKHPQQEFLQVDTSKILFICGGAFAGLDKVISHRVETGSGIGFGATVKAKSDKA
FT                   SEGELLAQVEPEDLIKFGLIPEFIGRLPVVATLNELSEEALIQILKEPKNALTKQYQAL
FT                   FNLEGVDLEFRDEALDAIAKKAMARKTGARGLRSIVEAALLDTMYDLPSMEDVEKVVID
FT                   ESVIDGQSKPLLIYGKPEAQQASGE"
     atgacagata aacgcaaaga tggctcaggc aaattgctgt attgctcttt ttgcggcaaa        60
     agccagcatg aagtgcgcaa gctgattgcc ggtccatccg tgtatatctg cgacgaatgt       120
     gttgatttat gtaacgacat cattcgcgaa gagattaaag aagttgcacc gcatcgtgaa       180
     cgcagtgcgc taccgacgcc gcatgaaatt cgcaaccacc tggacgatta cgttatcggc       240
     caggaacagg cgaaaaaagt gctggcggtc gcggtataca accattacaa acgtctgcgc       300
     aacggcgata ccagcaatgg cgtcgagttg ggcaaaagta acattctgct gatcggtccg       360
     accggttccg gtaaaacgct gctggctgaa acgctggcgc gcctgctgga tgttccgttc       420
     accatggccg acgcgactac actgaccgaa gccggttatg tgggtgaaga cgttgaaaac       480
     atcattcaga agctgttgca gaaatgcgac tacgatgtcc agaaagcaca gcgtggtatt       540
     gtctacatcg atgaaatcga caagatttct cgtaagtcag acaacccgtc cattacccga       600
     gacgtttccg gtgaaggcgt acagcaggca ctgttgaaac tgatcgaagg tacggtagct       660
     gctgttccac cgcaaggtgg gcgtaaacat ccgcagcagg aattcttgca ggttgatacc       720
     tctaagatcc tgtttatttg tggcggtgcg tttgccggtc tggataaagt gatttcccac       780
     cgtgtagaaa ccggctccgg cattggtttt ggcgcgacgg taaaagcgaa gtccgacaaa       840
     gcaagcgaag gcgagctgct ggcgcaggtt gaaccggaag atctgatcaa gtttggtctt       900
     atccctgagt ttattggtcg tctgccggtt gtcgcaacgt tgaatgaact gagcgaagaa       960
     gctctgattc agatcctcaa agagccgaaa aacgccctga ccaagcagta tcaggcgctg      1020
     tttaatctgg aaggcgtgga tctggaattc cgtgacgagg cgctggatgc tatcgctaag      1080
     aaagcgatgg cgcgtaaaac cggtgcccgt ggcctgcgtt ccatcgtaga agccgcactg      1140
     ctcgatacca tgtacgatct gccgtccatg gaagacgtcg aaaaagtggt tatcgacgag      1200
     tcggtaattg atggtcaaag caaaccgttg ctgatttatg gcaagccgga agcgcaacag      1260
     gcatctggtg aataa                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page