(data stored in ACNUC7421 zone)

EMBL: CP000948.CRCB

CP000948.CRCB        Location/Qualifiers
FT   CDS_pept        complement(596110..596493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="ECDH10B_0584"
FT                   /product="predicted inner membrane protein associated with
FT                   chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01747"
FT                   /protein_id="ACB01747.1"
FT                   /translation="MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGA
FT                   FIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVF
FT                   VNLLGSFAMTALAFWLFSASTAH"
     gtgttacaac ttcttttagc agtttttatt ggcggtggta cgggaagcgt ggcgagatgg        60
     ctgttaagta tgcgatttaa cccactgcat caggcgattc cgttggggac gctgacagca       120
     aacctgattg gggcattcat cataggaata ggattcgcat ggttcagcag gatgacgaac       180
     attgatccag tgtggaaagt attaatcacc accggatttt gtggcggtct aacaaccttc       240
     tcaacatttt cggcagaagt ggtgtttttg ttacaagagg gccgctttgg ctgggcatta       300
     ctgaacgttt tcgtcaacct tctggggtct tttgccatga ccgcactggc attctggctg       360
     ttttcggcct caaccgcaca ctaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page