(data stored in ACNUC7421 zone)

EMBL: CP000948.CSTA

CP000948.CSTA        Location/Qualifiers
FT   CDS_pept        568449..570554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="ECDH10B_0558"
FT                   /product="carbon starvation protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01721"
FT                   /protein_id="ACB01721.1"
FT                   /translation="MNKSGKYLVWTVLSVMGAFALGYIALNRGEQINALWIVVASVCIY
FT                   LIAYRFYGLYIAKNVLAVDPTRMTPAVRHNDGLDYVPTDKKVLFGHHFAAIAGAGPLVG
FT                   PVLAAQMGYLPGMIWLLAGVVLAGAVQDFMVLFVSTRRDGRSLGELVKEEMGPTAGVIA
FT                   LVACFMIMVIILAVLAMIVVKALTHSPWGTYTVAFTIPLALFMGIYLRYLRPGRIGEVS
FT                   VIGLVFLIFAIISGGWVAESPTWAPYFDFTGVQLTWMLVGYGFVAAVLPVWLLLAPRDY
FT                   LSTFLKIGTIVGLAVGILIMRPTLTMPALTKFVDGTGPVWTGNLFPFLFITIACGAVSG
FT                   FHALISSGTTPKMLANEGQACFIGYGGMLMESFVAIMALVSACIIDPGVYFAMNSPMAV
FT                   LAPAGTADVVASAAQVVSSWGFSITPDTLNQIASEVGEQSIISRAGGAPTLAVGMAYIL
FT                   HGALGGMMDVAFWYHFAILFEALFILTAVDAGTRAARFMLQDLLGVVSPGLKRTDSLPA
FT                   NLLATALCVLAWGYFLHQGVVDPLGGINTLWPLFGIANQMLAGMALMLCAVVLFKMKRQ
FT                   RYAWVALVPTAWLLICTLTAGWQKAFSPDAKVGFLAIANKFQAMIDSGNIPSQYTESQL
FT                   AQLVFNNRLDAGLTIFFMVVVVVLALFSIKTALAALKDPKPTAKETPYEPMPENVEEIV
FT                   AQAKGAH"
     atgaacaaat cagggaaata cctcgtctgg acagtgctct ctgtaatggg agcatttgct        60
     ctgggataca ttgctttaaa tcgtggggaa cagatcaacg cgctgtggat tgtggtggcg       120
     tcggtctgta tctatctgat cgcttaccgt ttttatgggc tgtatatcgc caaaaatgtg       180
     ctggcggttg acccgacgcg tatgacgcca gcggtgcgcc ataacgacgg gctggactat       240
     gtgccgacgg acaagaaagt gctgttcggt caccattttg cggccattgc cggagcaggt       300
     ccgctggtgg ggccggtact ggcggcgcaa atgggctacc tgccggggat gatctggctg       360
     ctcgctgggg tggttctcgc cggtgcggtg caggatttca tggtgctgtt tgtttctacg       420
     cgccgtgacg gtcgctcgct gggtgagctg gtcaaagaag agatggggcc aaccgccggg       480
     gtgattgcgc tggtggcctg ctttatgatc atggtcatta tccttgcagt gctggcgatg       540
     atcgtggtga aagccctgac tcatagcccg tggggaacat ataccgttgc gttcaccatt       600
     ccgctggcgc tgtttatggg gatctacctg cgctatctgc gtccggggcg tattggcgaa       660
     gtgtcggtca tcggtctggt attcctgatt ttcgccatta tctctggcgg ctgggtggca       720
     gaaagtccga cctgggcacc gtactttgac tttaccggcg tgcagttgac ctggatgctg       780
     gtgggttacg gttttgtggc ggcggtgctg ccggtgtggt tactgctggc cccgcgtgac       840
     tacctctcta ccttcctgaa aatcgggact atcgtcggtc tggcggtagg cattttgatt       900
     atgcgcccga cgctgaccat gcctgcgctg accaaatttg tcgatggcac tggcccggta       960
     tggaccggta acctgttccc gttcctgttt atcaccatcg cctgtggcgc ggtgtctggc      1020
     ttccatgcgc tgatctcttc tgggaccacg ccgaagatgc tggcgaacga agggcaggcg      1080
     tgctttatcg gctacggtgg gatgttaatg gaatccttcg tggcgattat ggcgctggtt      1140
     tccgcctgta tcatcgatcc gggcgtgtat tttgccatga acagcccgat ggcggtgctg      1200
     gctccggcag ggacggcgga tgtggtcgct tctgccgcgc aggtggtgag tagctggggc      1260
     tttagcatta caccagatac gctaaaccag attgccagcg aagtgggtga acagtcgatc      1320
     atttcccgtg cgggcggtgc gccgacgctg gcggtgggga tggcctacat tctgcacggc      1380
     gcgctgggcg gcatgatgga tgtggcgttc tggtatcact tcgccatttt gtttgaagca      1440
     ctgtttattc tgacggcggt ggatgcaggt acgcgtgctg cgcgctttat gttgcaggat      1500
     ctgctgggcg tggtgtctcc tggcctgaag cggaccgatt cactgcctgc taacctgctg      1560
     gcaacagcgc tgtgcgtact ggcgtggggc tacttcctcc atcagggcgt ggtcgatccg      1620
     ctgggcggca ttaacactct gtggccgctg tttggtattg ccaaccagat gctggcaggg      1680
     atggcgctga tgctctgtgc cgtggtgttg ttcaagatga aacgtcaacg ttacgcctgg      1740
     gtggcgctgg taccaacggc ctggctgctg atttgtaccc tgaccgcagg ctggcagaaa      1800
     gcgtttagcc cggatgcgaa agtcggcttc ctggccattg ctaataagtt ccaggcaatg      1860
     atcgacagcg gcaatattcc gtcgcagtat actgagtcac agctggcgca actggtgttc      1920
     aacaaccgtc tggatgccgg gttaaccatc ttctttatgg tggtcgtggt ggttctggca      1980
     ctgttctcga ttaagacggc acttgcggca ttgaaagatc cgaagccaac ggcgaaagaa      2040
     acgccgtatg aaccaatgcc ggaaaatgtc gaggagatcg tggcgcaggc aaaaggcgca      2100
     cactaa                                                                 2106
//

If you have problems or comments...

PBIL Back to PBIL home page