(data stored in ACNUC7421 zone)

EMBL: CP000948.CUSF

CP000948.CUSF        Location/Qualifiers
FT   CDS_pept        535686..536018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusF"
FT                   /locus_tag="ECDH10B_0531"
FT                   /product="periplasmic copper-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01694"
FT                   /protein_id="ACB01694.1"
FT                   /translation="MKKALQVAMFSLFTVIGFNAQANEHHHETMSEAQPQVISATGVVK
FT                   GIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQ
FT                   DIKVSQ"
     atgaaaaaag cactgcaagt cgcaatgttc agtctgttta ccgttattgg ctttaatgcc        60
     caggctaacg aacatcatca tgaaaccatg agcgaagcac aaccacaggt tattagcgcc       120
     actggcgtgg taaagggtat cgatctggaa agcaaaaaaa tcaccatcca tcacgatccg       180
     attgctgccg tgaactggcc ggagatgacc atgcgcttta ccatcacccc gcagacgaaa       240
     atgagtgaaa ttaaaaccgg cgacaaagtg gcgtttaatt ttgtccagca gggcaacctt       300
     tctttattac aggatattaa agtcagccag taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page