(data stored in ACNUC7421 zone)

EMBL: CP000948.CUSS

CP000948.CUSS        Location/Qualifiers
FT   CDS_pept        complement(531883..533325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusS"
FT                   /locus_tag="ECDH10B_0528"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with CusR, senses copper ions"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01691"
FT                   /protein_id="ACB01691.1"
FT                   /translation="MVSKPFQRPFSLATRLTFFISLATIAAFFAFAWIMIHSVKVHFAE
FT                   QDINDLKEISATLERVLNHPDETQARRLMTLEDIVSGYSNVLISLADSQGKTVYHSPGA
FT                   PDIREFTRDAIPDKDAQGGEVYLLSGPTMMMPGHGHGHMEHSNWRMINLPVGPLVDGKP
FT                   IYTLYIALSIDFHLHYINDLMNKLIMTASVISILIVFIVLLAVHKGHAPIRSVSRQIQN
FT                   ITSKDLDVRLDPQTVPIELEQLVLSFNHMIERIEDVFTRQSNFSADIAHEIRTPITNLI
FT                   TQTEIALSQSRSQKELEDVLYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLAD
FT                   EVGKVFDFFEALAEDRGVELRFVGDKCQVAGDPLMLRRALSNLLSNALRYTPTGETIVV
FT                   RCQTVDHLVQVIVENPGTPIAPEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVA
FT                   HKGTVAVTSDARGTRFVITLPA"
     atggtcagta agccatttca gcgcccgttt tcgctggcaa cccgcctgac cttttttatc        60
     agcctggcca ccatcgcggc gtttttcgcc tttgcatgga tcatgatcca ctcagtaaaa       120
     gttcattttg ccgagcagga tattaatgat ttaaaagaga ttagcgccac ccttgaacgg       180
     gtactaaatc accctgacga aacgcaagcc cgacgcttaa tgacgctgga agatatcgtc       240
     agtggttatt ccaatgtgtt gatttccctg gcagatagtc agggtaaaac ggtgtatcac       300
     tcccccggtg cgccggatat ccgcgagttt acgcgtgacg ccatacccga taaagacgct       360
     cagggtggcg aggtgtatct cctttccggc ccgacgatga tgatgccagg ccacggtcac       420
     gggcatatgg aacacagcaa ctggcggatg attaacttgc cggttggccc gttggtggac       480
     ggcaaaccga tttatacgct ctacatcgcg ctttcgatcg attttcatct tcattacata       540
     aatgatttga tgaataaact tattatgacc gcatcggtaa tcagcatcct gatcgtcttt       600
     atcgtactgt tggcggtaca taaaggtcac gcgccgatcc gcagcgtcag ccgtcaaatc       660
     cagaatatta cctcgaaaga tctcgacgtt cgcctcgacc cgcagaccgt gcccattgag       720
     ctggaacagc tggtactgtc gttcaaccat atgatcgagc gtattgagga tgtctttacc       780
     cgccagtcca atttctcagc ggatatcgct cacgaaattc gcacaccaat tacgaatctc       840
     ataacgcaaa ccgaaatcgc cctcagccag tcgcgcagcc agaaggagct ggaagatgtg       900
     ctctactcta atctcgaaga gctgacgcga atggcgaaaa tggtcagcga tatgctgttt       960
     ctcgctcagg ccgataacaa ccagctaatc cccgaaaaga aaatgctcaa cctggcggat      1020
     gaagtcggca aagtgttcga ttttttcgag gcgttagcgg aagatcgcgg cgtggagttg      1080
     cggtttgttg gcgacaagtg tcaggtcgcg ggcgatccgc tgatgctgcg tcgggcgcta      1140
     agcaacctgc tttcgaacgc cctgcgttat acgccaaccg gagagacaat tgtagtgcgc      1200
     tgtcagacgg tcgatcacct ggtgcaagtt atcgtcgaaa accccggtac gcccattgcg      1260
     cccgagcact taccgcgatt gtttgaccgt ttctatcgcg ttgacccctc ccgccagcga      1320
     aaaggtgaag gtagcggtat tggcctggcg atagtgaaat cgattgttgt cgcgcataaa      1380
     ggcacggttg cggtaacgtc ggatgcgcgg gggacaaggt ttgttatcac attacccgct      1440
     taa                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page