(data stored in ACNUC7421 zone)

EMBL: CP000948.CYOA

CP000948.CYOA        Location/Qualifiers
FT   CDS_pept        complement(389218..390165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="ECDH10B_0388"
FT                   /product="cytochrome o ubiquinol oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01560"
FT                   /protein_id="ACB01560.1"
FT                   /translation="MRLRKYNKSLGWLSLFAGTVLLSGCNSALLDPKGQIGLEQRSLIL
FT                   TAFGLMLIVVIPAILMAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLA
FT                   VLTWKTTHALEPSKPLAHDEKPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANTPVYF
FT                   KVTSNSVMNSFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGMKFKA
FT                   IATPDRAAFDQWVAKAKQSPNTMSDMAAFEKLAAPSEYNQVEYFSNVKPDLFADVINKF
FT                   MAHGKSMDMTQPEGEHSAHEGMEGMDMSHAESAH"
     atgagactca ggaaatacaa taaaagtttg ggatggttgt cattatttgc aggcactgta        60
     ttgctcagtg gctgtaattc tgcgctgtta gatcccaaag gacagattgg tctggagcaa       120
     cgttcactga tactgacggc atttggcctg atgttgattg tcgttattcc cgcaatcttg       180
     atggctgttg gtttcgcctg gaagtaccgt gcgagcaata aagatgctaa gtacagcccg       240
     aactggtcac actccaataa agtggaagct gtggtctgga cggtacctat cttaatcatc       300
     atcttccttg cagtactgac ctggaaaacc actcacgctc ttgagcctag caagccgctg       360
     gcacacgacg agaagcccat taccatcgaa gtggtttcca tggactggaa atggttcttc       420
     atctacccgg aacagggcat tgctaccgtg aatgaaatcg ctttcccggc gaacactccg       480
     gtgtacttca aagtgacctc caactccgtg atgaactcct tcttcattcc gcgtctgggt       540
     agccagattt atgccatggc cggtatgcag actcgcctgc atctgatcgc caacgaaccc       600
     ggcacttatg acggtatctc cgccagctac agcggcccgg gcttctcagg catgaagttc       660
     aaagctattg caacaccgga tcgcgccgca ttcgaccagt gggtcgcaaa agcgaagcag       720
     tcgccgaaca ccatgtctga catggctgcg ttcgaaaaac tggccgcgcc tagcgaatac       780
     aaccaggtgg aatatttctc caacgtgaaa ccagacttgt ttgccgatgt aattaacaag       840
     tttatggctc acggtaagag catggacatg acccagccag aaggtgagca cagcgcacac       900
     gaaggtatgg aaggcatgga catgagccac gcggaatccg cccattaa                    948
//

If you have problems or comments...

PBIL Back to PBIL home page