(data stored in ACNUC7421 zone)

EMBL: CP000948.CYOB

CP000948.CYOB        Location/Qualifiers
FT   CDS_pept        complement(387205..389196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="ECDH10B_0387"
FT                   /product="cytochrome o ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01559"
FT                   /protein_id="ACB01559.1"
FT                   /translation="MFGKLSLDAVPFHEPIVMVTIAGIILGGLALVGLITYFGKWTYLW
FT                   KEWLTSVDHKRLGIMYIIVAIVMLLRGFADAIMMRSQQALASAGEAGFLPPHHYDQIFT
FT                   AHGVIMIFFVAMPFVIGLMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNVSLGVG
FT                   EFAQTGWLAYPPLSGIEYSPGVGVDYWIWSLQLSGIGTTLTGINFFVTILKMRAPGMTM
FT                   FKMPVFTWASLCANVLIIASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYINLIWA
FT                   WGHPEVYILILPVFGVFSEIAATFSRKRLFGYTSLVWATVCITVLSFIVWLHHFFTMGA
FT                   GANVNAFFGITTMIIAIPTGVKIFNWLFTMYQGRIVFHSAMLWTIGFIVTFSVGGMTGV
FT                   LLAVPGADFVLHNSLFLIAHFHNVIIGGVVFGCFAGMTYWWPKAFGFKLNETWGKRAFW
FT                   FWIIGFFVAFMPLYALGFMGMTRRLSQQIDPQFHTMLMIAASGAVLIALGILCLVIQMY
FT                   VSIRDRDQNRDLTGDPWGGRTLEWATSSPPPFYNFAVVPHVHERDAFWEMKEKGEAYKK
FT                   PDHYEEIHMPKNSGAGIVIAAFSTIFGFAMIWHIWWLAIVGFAGMIITWIVKSFDEDVD
FT                   YYVPVAEIEKLENQHFDEITKAGLKNGN"
     atgttcggaa aattatcact tgatgcagtc ccgttccatg aacctatcgt catggttacg        60
     atcgctggca ttattttggg aggtctggcg ctcgttggcc tgatcactta cttcggtaag       120
     tggacctacc tgtggaaaga gtggctgacc tccgtcgacc ataaacgcct cggtatcatg       180
     tatatcatcg tggcgattgt gatgttgctg cgtggttttg ctgacgccat tatgatgcgt       240
     agccagcagg ctcttgcctc ggcgggcgaa gcgggcttcc tgccacctca ccactacgat       300
     cagatcttta ccgcgcacgg cgtgattatg atcttcttcg tggcgatgcc tttcgttatc       360
     ggtctgatga acctggtggt tccgctgcag atcggcgcgc gtgacgttgc gttcccgttc       420
     ctcaacaact taagcttctg gtttaccgtt gttggtgtga ttctggttaa cgtttctctc       480
     ggcgtgggcg aatttgcgca gaccggctgg ctggcctatc caccgctatc gggaatagag       540
     tacagtccgg gagtcggtgt cgattactgg atatggagtc tccagctatc cggtataggt       600
     acgacgctta ccggtatcaa cttcttcgtt accattctga agatgcgcgc accgggcatg       660
     accatgttca agatgccagt atttacctgg gcatcactgt gcgcgaacgt actgattatt       720
     gcttccttcc caattctgac ggttaccgtc gcgttgttga ccctggatcg ctatctgggc       780
     acccatttct ttaccaacga tatgggtggc aacatgatga tgtacatcaa cctgatttgg       840
     gcctggggcc acccggaagt ttacatcctg atcctgcctg ttttcggtgt gttctccgaa       900
     attgcggcaa ccttctcgcg taaacgtctg tttggttata cctcgctggt atgggcaacc       960
     gtctgtatca ccgtgctgtc gttcatcgtt tggctgcacc acttctttac gatgggtgcg      1020
     ggcgcgaacg taaacgcctt ctttggtatc accacaatga ttatcgccat cccgaccggg      1080
     gtgaagatct tcaactggct gttcaccatg tatcagggcc gcatcgtgtt ccattctgcg      1140
     atgctgtgga ccatcggttt tatcgtcacc ttctcggtgg gcgggatgac tggcgtgctg      1200
     ctggccgtac cgggcgcgga cttcgttctg cataacagcc tgttcctgat tgcgcacttc      1260
     cataacgtga tcatcggcgg cgtggtcttc ggctgcttcg cagggatgac ctactggtgg      1320
     cctaaagcgt tcggtttcaa actgaacgaa acctggggta aacgcgcgtt ctggttctgg      1380
     atcatcggct tcttcgttgc ctttatgcca ctgtatgcgc tgggcttcat gggcatgacc      1440
     cgtcgtttga gccagcagat tgacccgcag ttccacacca tgctgatgat tgcagccagc      1500
     ggtgcagtac tgattgcgct gggtattctc tgcctcgtta ttcagatgta cgtttctatt      1560
     cgcgaccgcg accagaaccg tgacctgact ggcgacccgt ggggtggccg tacgctggag      1620
     tgggcaacct cttccccgcc tccgttctat aactttgccg tagtgccgca cgttcacgaa      1680
     cgtgatgcat tctgggaaat gaaagagaaa ggcgaagcgt ataaaaagcc tgaccactat      1740
     gaagaaattc atatgccgaa aaacagcggt gcaggtatcg tcattgcagc tttctccacc      1800
     atcttcggtt tcgccatgat ctggcatatc tggtggctgg cgattgttgg cttcgcaggc      1860
     atgatcatca cctggatcgt gaaaagcttc gacgaggacg tggattacta cgtgccggtg      1920
     gcagaaatcg aaaaactgga aaaccagcat ttcgatgaga ttactaaggc agggctgaaa      1980
     aatggcaact ga                                                          1992
//

If you have problems or comments...

PBIL Back to PBIL home page