(data stored in ACNUC7421 zone)

EMBL: CP000948.CYOC

CP000948.CYOC        Location/Qualifiers
FT   CDS_pept        complement(386601..387215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="ECDH10B_0386"
FT                   /product="cytochrome o ubiquinol oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01558"
FT                   /protein_id="ACB01558.1"
FT                   /translation="MATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFA
FT                   TYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLAL
FT                   TWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQ
FT                   IARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGAM"
     atggcaactg atactttgac gcacgcgact gcccacgcgc acgaacacgg gcaccacgat        60
     gcaggcggaa ccaaaatctt cggattttgg atctacctga tgagcgactg cattctgttc       120
     tctatcttgt ttgctaccta tgccgttctg gtgaacggca ccgcaggcgg cccgacaggt       180
     aaggacattt tcgaactgcc gttcgttctg gttgaaactt tcttgctgtt gttcagctcc       240
     atcacctacg gcatggcggc tatcgccatg tacaaaaaca acaaaagcca ggttatctcc       300
     tggctggcgt tgacctggtt gtttggtgcc ggatttatcg ggatggaaat ctatgaattc       360
     catcacctga ttgttaacgg catgggtccg gatcgcagcg gcttcctgtc agcgttcttt       420
     gcgctggtcg gcacgcacgg tctgcacgtc acttctggtc ttatctggat ggcggtgctg       480
     atggtgcaaa tcgcccgtcg cggcctgacc agcactaacc gtacccgcat catgtgcctg       540
     agcctgttct ggcacttcct ggatgtggtt tggatctgtg tgttcactgt tgtttatctg       600
     atgggggcga tgtaa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page