(data stored in ACNUC7421 zone)

EMBL: CP000948.DJLA

CP000948.DJLA        Location/Qualifiers
FT   CDS_pept        57364..58179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="ECDH10B_0056"
FT                   /product="DnaJ-like protein, membrane anchored"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01260"
FT                   /protein_id="ACB01260.1"
FT                   /translation="MQYWGKIIGVAVALLMGGGFWGVVLGLLIGHMFDKARSRKMAWFA
FT                   NQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGASRTAAQNAFRVG
FT                   KSDNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNERAVLYVIAEELGI
FT                   SRAQFDQFLRMMQGGAQFGGGYQQQTGGGNWQQAQRGPTLEDACNVLGVKPTDDATTIK
FT                   RAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELIKQQKGFK"
     atgcagtatt ggggaaaaat cattggcgtg gccgtggcct tactgatggg cggcggcttt        60
     tggggcgtag tgttaggcct gttaattggc catatgtttg ataaagcccg tagccgtaaa       120
     atggcgtggt tcgccaacca gcgtgagcgt caggcgctgt tttttgccac cacttttgaa       180
     gtgatggggc atttaaccaa atccaaaggt cgcgtcacgg aggctgatat tcatatcgcc       240
     agccagttga tggaccgaat gaatcttcat ggcgcttccc gtactgcggc gcaaaatgcg       300
     ttccgggtgg gaaaatcaga caattacccg ctgcgcgaaa agatgcgcca gtttcgcagt       360
     gtctgctttg gtcgttttga cttaattcgt atgtttctgg agatccagat tcaggcggcg       420
     tttgctgatg gttcactgca cccgaatgaa cgggcggtgc tgtatgtcat tgcagaagaa       480
     ttagggatct cccgcgctca gtttgaccag tttttgcgca tgatgcaggg cggtgcacag       540
     tttggcggcg gttatcagca gcaaactggc ggtggtaact ggcagcaagc gcagcgtggc       600
     ccaacgctgg aagatgcctg taatgtgctg ggcgtgaagc cgacggatga tgcgaccacc       660
     atcaaacgtg cctaccgtaa gctgatgagt gaacaccatc ccgataagct ggtggcgaaa       720
     ggtttgccgc ctgagatgat ggagatggcg aagcagaaag cgcaggaaat tcagcaggca       780
     tatgagctga taaagcagca gaaagggttt aaatga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page