(data stored in ACNUC7421 zone)

EMBL: CP000948.DNAQ

CP000948.DNAQ        Location/Qualifiers
FT   CDS_pept        210171..210902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="ECDH10B_0196"
FT                   /product="DNA polymerase III epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01388"
FT                   /protein_id="ACB01388.1"
FT                   /translation="MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTG
FT                   NNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDI
FT                   GFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHG
FT                   ALLDAQILAEVYLAMTGGQTSMAFAMEGETQQQQGEATIQRIVRQASKLRVVFATDEEI
FT                   AAHEARLDLVQKKGGSCLWRA"
     atgagcactg caattacacg ccagatcgtt ctcgataccg aaaccaccgg tatgaaccag        60
     attggtgcgc actatgaagg ccacaagatc attgagattg gtgccgttga agtggtgaac       120
     cgtcgcctga cgggcaataa cttccatgtt tatctcaaac ccgatcggct ggtggatccg       180
     gaagcctttg gcgtacatgg tattgccgat gaatttttgc tcgataagcc cacgtttgcc       240
     gaagtagccg atgagttcat ggactatatt cgcggcgcgg agttggtgat ccataacgca       300
     gcgttcgata tcggctttat ggactacgag ttttcgttgc ttaagcgcga tattccgaag       360
     accaatactt tctgtaaggt caccgatagc cttgcggtgg cgaggaaaat gtttcccggt       420
     aagcgcaaca gcctcgatgc gttatgtgct cgctacgaaa tagataacag taaacgaacg       480
     ctgcacgggg cattactcga tgcccagatc cttgcggaag tttatctggc gatgaccggt       540
     ggtcaaacgt cgatggcttt tgcgatggaa ggagagacac aacagcaaca aggtgaagca       600
     acaattcagc gcattgtacg tcaggcaagt aagttacgcg ttgtttttgc gacagatgaa       660
     gagattgcag ctcatgaagc ccgtctcgat ctggtgcaga agaaaggcgg aagttgcctc       720
     tggcgagcat aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page