(data stored in ACNUC7421 zone)

EMBL: CP000948.EAEH

CP000948.EAEH        Location/Qualifiers
FT   CDS_pept        289131..290018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eaeH"
FT                   /locus_tag="ECDH10B_0286"
FT                   /product="attaching and effacing protein, pathogenesis
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01464"
FT                   /protein_id="ACB01464.1"
FT                   /translation="MSHYKTGHKQPRFRYSVLARCVAWANISVQVLFPLAVTFTPVMAA
FT                   RAQHAVQPRLSMGNTTVTADNNVEKNVASFAANAGTFLSSQPDSDATRNFITGMATAKA
FT                   NQEIQEWLGKYGTARVKLNVDKDFSLKDSSLEMLYPIYDTPTNMLFTQGAIHRTDDRTQ
FT                   SNIGFGWRHFSGNDWMAGVNTFIDHDLSRSHTRIGVGAEYWRDYLKLSANGYIRASGWK
FT                   KSPDIEDYQERPANGWDIRAEGYLPAWPQLGASLMYEQYYGDEVGLFGKDKRQKDPHAI
FT                   SAEVTYTPVPLTQQ"
     atgtcacatt ataaaacagg tcataaacaa ccacgatttc gttattcagt tctggcccgc        60
     tgcgtggcgt gggcaaatat ctctgttcag gttctttttc cactcgctgt cacctttacc       120
     ccagtaatgg cggcacgtgc gcagcatgcg gttcagccac ggttgagcat gggaaatact       180
     acggtaactg ctgataataa cgtggagaaa aatgtcgcgt cgtttgccgc aaatgccggg       240
     acatttttaa gcagtcagcc agatagcgat gcgacacgta actttattac cggaatggcc       300
     acagctaaag ctaaccagga aatacaggag tggctcggga aatatggtac tgcgcgcgtc       360
     aaactgaatg tcgataaaga tttctcgctg aaggattctt cgctggaaat gctttatccg       420
     atttatgata cgccgacaaa tatgttgttc actcaggggg caatacatcg tacagacgat       480
     cgtactcagt caaatattgg ttttggctgg cgtcattttt caggaaatga ctggatggcg       540
     ggggtgaata cttttatcga tcatgattta tcccgtagtc atacccgcat tggtgttggt       600
     gcggaatact ggcgcgatta tctgaaactg agcgccaatg gttatattcg ggcttctggc       660
     tggaaaaaat cgccggatat tgaggattat caggaacgcc cggcgaatgg ctgggatatt       720
     cgtgctgagg gctatttacc cgcctggccg cagcttggcg caagcctgat gtatgaacag       780
     tattatggcg atgaagtcgg gctgtttggt aaagataagc gccagaaaga cccgcatgct       840
     atttctgccg aggtgaccta tacgccagtg cctcttaccc agcaatag                    888
//

If you have problems or comments...

PBIL Back to PBIL home page